Protein
MCA_03722_1
Length
596 amino acids
Gene name: MDM34
Description: Mitochondrial distribution and morphology protein 34; Saccharomyces cerevisiae homologue is a component of the ERMES complex
Browser: contigC:883023-884814+
RNA-seq: read pairs 5119, FPKM 105.9, percentile rank 79.7% (100% = highest expression)
Protein function
| Annotation: | MDM34 | Mitochondrial distribution and morphology protein 34; Saccharomyces cerevisiae homologue is a component of the ERMES complex | |
|---|---|---|---|
| KEGG: | K17775 | MDM34 | mitochondrial distribution and morphology protein 34 |
| EGGNOG: | 0PIAF | MDM34 | Component of the ERMES MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria. Components of this complex are involved in the control of mitochondrial shape and protein biogenesis and may function in phospholipid exchange. mdm34 is required for the interaction of the ER-resident membrane protein mmm1 and the outer mitochondrial membrane-resident beta-barrel protein mdm10 (By similarity) |
| SGD closest match: | S000003187 | MDM34 | Mitochondrial distribution and morphology protein 34 |
| CGD closest match: | CAL0000184363 | MDM34 | Mitochondrial distribution and morphology protein 34 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04864_1 | 65.70% | 379 | 4e-167 | MIA_04864_1 |
| A0A0J9XHG0_GEOCN | 63.56% | 365 | 3e-153 | Mitochondrial distribution and morphology protein 34 OS=Geotrichum candidum GN=MDM34 PE=3 SV=1 |
| UniRef50_A0A0J9XHG0 | 63.56% | 365 | 6e-150 | Mitochondrial distribution and morphology protein 34 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHG0_GEOCN |
| A0A167EVQ3_9ASCO | 58.20% | 366 | 5e-136 | Mitochondrial distribution and morphology protein 34 OS=Sugiyamaella lignohabitans GN=MDM34 PE=3 SV=1 |
| A0A1E3PR98_9ASCO | 53.80% | 368 | 5e-126 | Mitochondrial distribution and morphology protein 34 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=MDM34 PE=3 SV=1 |
| MDM34_YARLI | 53.30% | 364 | 2e-119 | Mitochondrial distribution and morphology protein 34 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDM34 PE=3 SV=1 |
| A0A060T8C2_BLAAD | 52.75% | 364 | 2e-116 | Mitochondrial distribution and morphology protein 34 OS=Blastobotrys adeninivorans GN=MDM34 PE=3 SV=1 |
| A0A1E4TDK4_9ASCO | 55.15% | 194 | 3e-71 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13309 PE=4 SV=1 |
| MDM34_CANAL | 47.84% | 232 | 1e-60 | Mitochondrial distribution and morphology protein 34 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDM34 PE=3 SV=2 |
| MDM34_YEAST | 25.42% | 421 | 4e-17 | Mitochondrial distribution and morphology protein 34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM34 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0590
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_03722_1 MSFRFNWDFFNDEDFYDRVQTLLTDALNKGTNPPILADKIKVRELYLGDESPQLEILEVGDLAEDRFRGIFKLTYNGNAS ITLQTKIRANPLQVYAMSAPEFCLPNFHGAANGSLAIPLNITLSDIQLSGIIILVFSKAKGLTLVFRNDPLQSIRVTSTF DTLPGIARFLQVQIEKQIRSLFREDLPAILHKLSHRWTPSGSFVLEKQKLIEHQQKQKLHNNTNMDEKNSNVHSESVSED SNHLHYPPHLYPTVDDNDDTTQQSKEPEFVSFADINPEMPALSPSNMLKLNTLCASQQTLSLFTPVIPEAVYRANLEAYH DPRAKSHIQNLEGNVDLDEIARIQSKNYFRNSHTKPKRRVIKLNNKSQASSTEASSSSNNNNNATSVSAGKESVAVSNTT PSLVPIKTREAKKSSTAATIPSKPEYTQEPHAHFDLPAYHSSASSNTSNEAISPEKNIKNSRNASATYSAMEKQSTAKPE SGTAATPRQKKNSKQTPKLKISTLATPTTTPTPENKFSNPLIRDEKNALKILYNKTISSNTNSPMPVEEHAVYEKNSSSN KKKNNQSKPILSRLGEKRTVVVDDHFYHAPPPAYDA
GO term prediction
Biological Process
GO:0007005 mitochondrion organization
Molecular Function
None predicted.
Cellular Component
GO:0032865 ERMES complex