Protein
MIA_05600_1
Length
108 amino acids
Browser: contig08:903624-904121+
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XJ58_GEOCN | 57.143% | 70 | 2.02e-24 | Similar to Saccharomyces cerevisiae YBR253W SRB6 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA22s01121g PE=4 SV=1 |
| UniRef50_A0A0J9XJ58 | 57.143% | 70 | 4.14e-21 | Similar to Saccharomyces cerevisiae YBR253W SRB6 Subunit of the RNA polymerase II mediator complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJ58_GEOCN |
| MCA_02009_1 | 53.623% | 69 | 3.10e-23 | MCA_02009_1 |
| A0A1E3PFI6_9ASCO | 53.521% | 71 | 7.34e-20 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53050 PE=4 SV=1 |
| MED22_YARLI | 42.000% | 100 | 6.99e-18 | Mediator of RNA polymerase II transcription subunit 22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB6 PE=3 SV=2 |
| A0A1E4TK51_9ASCO | 35.065% | 77 | 4.04e-11 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_714 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0329
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_05600_1 MILRNKKVNIATATLAEEFKQIIDLSKNAGKDSATVASEVYQTEASTASIVHAAEDLLAVTRVLKEAWILGQVRPQESAE PVLRTPDGKAIDVTAMAEQLLEEILKGS
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex