Protein
MIA_05590_1
Length
149 amino acids
Browser: contig08:887051-887501-
Protein function
EGGNOG: | 0PNQT | RPL24 | 60S ribosomal protein L24 |
---|---|---|---|
SGD closest match: | S000002999 | RPL24A | 60S ribosomal protein L24-A |
CGD closest match: | CAL0000190222 | RPL24A | Ribosomal 60S subunit protein L24A |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_02001_1 | 81.333% | 150 | 6.97e-55 | MCA_02001_1 |
A0A0J9X4L1_GEOCN | 77.660% | 94 | 1.01e-50 | Similar to Saccharomyces cerevisiae YGL031C RPL24A Ribosomal 60S subunit protein L24A OS=Geotrichum candidum GN=BN980_GECA01s10526g PE=4 SV=1 |
Q5A6A1_CANAL | 76.596% | 94 | 5.84e-51 | Ribosomal 60S subunit protein L24A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL24A PE=4 SV=1 |
UniRef50_A0A0F4X5H8 | 73.404% | 94 | 8.59e-46 | 60S ribosomal protein L24-B n=11 Tax=Fungi TaxID=4751 RepID=A0A0F4X5H8_HANUV |
RL24_YARLI | 72.917% | 96 | 1.06e-48 | 60S ribosomal protein L24 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL24 PE=3 SV=1 |
RL24A_YEAST | 72.340% | 94 | 3.34e-48 | 60S ribosomal protein L24-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL24A PE=1 SV=1 |
A0A060T4E5_BLAAD | 71.277% | 94 | 3.74e-47 | ARAD1C44374p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C44374g PE=4 SV=1 |
A0A1E3PJL5_9ASCO | 69.792% | 96 | 1.26e-45 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51988 PE=4 SV=1 |
A0A1E4TG89_9ASCO | 70.213% | 94 | 5.33e-38 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2510 PE=4 SV=1 |
A0A167CH97_9ASCO | 66.667% | 78 | 1.22e-33 | Ribosomal 60S subunit protein L24B OS=Sugiyamaella lignohabitans GN=RPL24B PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0269
Protein family membership
- Ribosomal protein L24e-related (IPR000988)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01073 (RIBOSOMAL_...)
-

Unintegrated signatures
-
-
-
SSF57716 (Glucocort...)
-
mobidb-lite (disord...)
Residue annotation
-
zinc binding site ...
-
L3 interface cd00472
-
L14 interface cd00...
-
23S rRNA interface...
Protein sequence
>MIA_05590_1 MKIEIDSFSGSKVYPGRGTLFVRSDSRIFRFQSSKTASLFHQRLNPRKISWTIVYRKQHKKGITEEVAKKRTRKTVKNLR AVGGASVEVLKEKRRAGVSVQSKTQAAQAAKKKERADKAKSAVAHSRGAPKVSKQQAKGAQQKVQATSR
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.