Protein
MCA_02001_1
Length
150 amino acids
Gene name: RPL24
Description: 60S ribosomal protein L24
Browser: contigB:14876-15329-
RNA-seq: read pairs 54352, FPKM 4447.5, percentile rank 99.4% (100% = highest expression)
Protein function
| Annotation: | RPL24 | 60S ribosomal protein L24 | |
|---|---|---|---|
| KEGG: | K02896 | RP-L24e | large subunit ribosomal protein L24e |
| EGGNOG: | 0PNQT | RPL24 | 60S ribosomal protein L24 |
| SGD closest match: | S000003380 | RPL24B | 60S ribosomal protein L24-B |
| CGD closest match: | CAL0000190222 | RPL24A | Ribosomal 60S subunit protein L24A |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05590_1 | 81.33% | 150 | 2e-68 | MIA_05590_1 |
| RL24_YARLI | 59.35% | 155 | 1e-51 | 60S ribosomal protein L24 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL24 PE=3 SV=1 |
| UniRef50_Q6C4U6 | 59.35% | 155 | 2e-48 | 60S ribosomal protein L24 n=16 Tax=Fungi TaxID=4751 RepID=RL24_YARLI |
| A0A0J9XDF3_GEOCN | 56.86% | 153 | 8e-50 | Similar to Saccharomyces cerevisiae YGL031C RPL24A Ribosomal 60S subunit protein L24A OS=Geotrichum candidum GN=BN980_GECA10s02771g PE=4 SV=1 |
| Q5A6A1_CANAL | 58.71% | 155 | 4e-47 | Ribosomal 60S subunit protein L24A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL24A PE=4 SV=1 |
| A0A1E3PJL5_9ASCO | 56.00% | 150 | 8e-47 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51988 PE=4 SV=1 |
| RL24B_YEAST | 57.42% | 155 | 3e-46 | 60S ribosomal protein L24-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL24B PE=1 SV=1 |
| A0A060T4E5_BLAAD | 62.00% | 100 | 3e-41 | ARAD1C44374p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C44374g PE=4 SV=1 |
| A0A167CH97_9ASCO | 56.52% | 138 | 4e-35 | Ribosomal 60S subunit protein L24B OS=Sugiyamaella lignohabitans GN=RPL24B PE=4 SV=1 |
| A0A1E4TG89_9ASCO | 67.02% | 94 | 8e-35 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2510 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0808
Protein family membership
- Ribosomal protein L24e-related (IPR000988)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01073 (RIBOSOMAL_...)
-
no IPR
Unintegrated signatures
-
-
SSF57716 (Glucocort...)
-
mobidb-lite (disord...)
Residue annotation
-
zinc binding site ...
-
L3 interface cd00472
-
L14 interface cd00...
-
23S rRNA interface...
Protein sequence
>MCA_02001_1 MKIDIDYFSGFKVYPGRGTLFVRGDSKTFRFFSSKTASLFHQRLNRQKISWTAVYRKQHKKGITEEVSKKRTRKTVKQMR PIVGASVETLKQKRRAGPSVSSRTQTSQAAKKKERADKAKSAAAHHRGGAPKISKQQAKGAQPKVQATSR
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.