Protein

MIA_05583_1

Length
273 amino acids


Browser: contig08:875919-876836-

Protein function

EGGNOG:0PHF0FG05222.1The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000004931PRE5Proteasome subunit alpha type-6
CGD closest match:CAL0000174387PRE5Proteasome endopeptidase complex

Protein alignments

%idAln lengthE-value
MCA_01997_182.510%2636.07e-160MCA_01997_1
A0A0J9X827_GEOCN75.188%2661.72e-145Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA04s07314g PE=3 SV=1
A0A060TCY6_BLAAD81.057%2272.42e-138Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B19580g PE=3 SV=1
Q6CBM3_YARLI77.500%2404.12e-137Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C17325g PE=3 SV=2
A0A1E3PT42_9ASCO73.820%2335.71e-129Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45104 PE=3 SV=1
A0A1E4TEM6_9ASCO62.055%2531.74e-114Proteasome endopeptidase complex OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_43836 PE=3 SV=1
A0A1D8PRH6_CANAL67.257%2262.65e-109Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE5 PE=3 SV=1
UniRef50_S8ACH264.435%2392.79e-101Proteasome endopeptidase complex n=1 Tax=Dactylellina haptotyla (strain CBS 200.50) TaxID=1284197 RepID=S8ACH2_DACHA
A0A161HGK5_9ASCO77.301%1632.44e-92Proteasome endopeptidase complex OS=Sugiyamaella lignohabitans GN=PRE5 PE=3 SV=1
PSA6_YEAST59.545%2205.93e-87Proteasome subunit alpha type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE5 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0679

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 273

Detailed signature matches

    1. PF00227 (Proteasome)
    1. PS51475 (PROTEASOME...)
    1. cd03749 (proteasome...)
    1. SSF56235 (N-termina...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. alpha subunit inte...
  2. active site cd03749

Protein sequence

>MIA_05583_1
MITMQLYQVEYALEAVKQGSASVGLVSKTHAVLVALKRNTEDLGSYQKKLIGIDTHMGVALAGLAPDARILSNFLRQRAM
SSRLVYGRPLPVSRAVYSIADKAQGNTQQYGRRPYGVGLLIIGHDNKGPHLYEFLPSGSVLEYFGTAIGARSQAARTYLE
RNFQDFPDATLEQLIVHGLNALRDTLAQDKELTPKNTSIAFLGADTPFKILDDDLVTPWLDRLDSLSRTSHPLNTSTDEA
TEEEQSQPTTDDTTENQGSTDAPADPDAMDTTE

GO term prediction

Biological Process

GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex