Protein
MCA_01997_1
Length
286 amino acids
Browser: contigB:10604-11575-
RNA-seq: read pairs 5723, FPKM 246.4, percentile rank 90.3% (100% = highest expression)
Protein function
KEGG: | K02725 | PSMA1 | 20S proteasome subunit alpha 6 [EC:3.4.25.1] |
---|---|---|---|
EGGNOG: | 0PHF0 | FG05222.1 | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) |
SGD closest match: | S000004931 | PRE5 | Proteasome subunit alpha type-6 |
CGD closest match: | CAL0000174387 | PRE5 | Proteasome endopeptidase complex |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05583_1 | 80.44% | 271 | 6e-160 | MIA_05583_1 |
A0A0J9X827_GEOCN | 75.87% | 286 | 9e-157 | Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA04s07314g PE=3 SV=1 |
A0A060TCY6_BLAAD | 76.95% | 256 | 1e-146 | Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B19580g PE=3 SV=1 |
Q6CBM3_YARLI | 75.68% | 259 | 6e-146 | Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C17325g PE=3 SV=2 |
A0A1E3PT42_9ASCO | 73.55% | 242 | 2e-137 | Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45104 PE=3 SV=1 |
A0A1E4TEM6_9ASCO | 64.42% | 267 | 5e-125 | Proteasome endopeptidase complex OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_43836 PE=3 SV=1 |
A0A1D8PRH6_CANAL | 70.00% | 240 | 3e-122 | Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE5 PE=3 SV=1 |
UniRef50_O14250 | 62.55% | 235 | 3e-109 | Probable proteasome subunit alpha type-6 n=397 Tax=Eukaryota TaxID=2759 RepID=PSA6_SCHPO |
PSA6_YEAST | 60.26% | 234 | 9e-97 | Proteasome subunit alpha type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE5 PE=1 SV=1 |
A0A161HGK5_9ASCO | 74.40% | 168 | 4e-90 | Proteasome endopeptidase complex OS=Sugiyamaella lignohabitans GN=PRE5 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0340
Protein family membership
- Proteasome, subunit alpha/beta (IPR001353)
- Proteasome alpha-type subunit (IPR023332)
- Proteasome subunit alpha 1 (IPR035144)
- Proteasome alpha-type subunit (IPR023332)
Domains and repeats
-
Domain
-
Domain
1
50
100
150
200
250
286
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Residue annotation
-
alpha subunit inte...
-
active site cd03749
Protein sequence
>MCA_01997_1 MITIAHLFHFRNSYDNDAVTYSPTGRLYQVEYALEAVKQGSASVGLVSSTHAVLVALKRNTEDLGSYQKKIIGIDSHIGV ALAGLAPDARILSNFLRQRAMSSKLVFGRPLPISKAVYAIADKAQSNTQQYGRRPYGVGLIIIGHDSKGPHLYEFLPSGS VLEYFGTAIGARSQAARTYLERNFQEFPNATLEELIIHGLNALRDTLAQDKELTPKNTNIAFLGKDTPFKILEDDAVTPW LEKLDSVSRTSHPLSSNQQENDDEPTNEEGDGNTEGQNATTMDTTE
GO term prediction
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in cellular protein catabolic process
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
Cellular Component
GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex