Protein
MIA_05556_1
Length
227 amino acids
Browser: contig08:805007-805789+
Protein function
| EGGNOG: | 0PGK8 | FG00564.1 | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) |
|---|---|---|---|
| SGD closest match: | S000005889 | PRE10 | Probable proteasome subunit alpha type-7 |
| CGD closest match: | CAL0000177938 | PRE10 | Proteasome endopeptidase complex |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02053_1 | 85.581% | 215 | 1.59e-130 | MCA_02053_1 |
| A0A0J9XC06_GEOCN | 82.326% | 215 | 7.82e-128 | Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA09s03585g PE=3 SV=1 |
| A0A1E3PN21_9ASCO | 76.056% | 213 | 4.17e-118 | Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82538 PE=3 SV=1 |
| A0A060TC35_BLAAD | 78.404% | 213 | 1.65e-117 | Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B19888g PE=3 SV=1 |
| Q6C2J2_YARLI | 68.396% | 212 | 1.03e-105 | Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F07469g PE=3 SV=1 |
| A0A1D8PQW1_CANAL | 64.789% | 213 | 5.12e-102 | Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE10 PE=3 SV=1 |
| PSA7_YEAST | 65.278% | 216 | 3.93e-96 | Probable proteasome subunit alpha type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE10 PE=1 SV=2 |
| UniRef50_P21242 | 65.278% | 216 | 9.39e-93 | Probable proteasome subunit alpha type-7 n=42 Tax=saccharomyceta TaxID=716545 RepID=PSA7_YEAST |
| A0A1E4TFJ1_9ASCO | 58.962% | 212 | 4.36e-87 | Proteasome endopeptidase complex OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31463 PE=3 SV=1 |
| A0A167F7Z8_9ASCO | 80.645% | 93 | 3.01e-43 | Proteasome core particle subunit alpha 7 OS=Sugiyamaella lignohabitans GN=PRE10 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0197
Protein family membership
- Proteasome, subunit alpha/beta (IPR001353)
- Proteasome alpha-type subunit (IPR023332)
Domains and repeats
-
Domain
1
50
100
150
200
227
Detailed signature matches
Protein sequence
>MIA_05556_1 MKAVENAGTSIGIKFKDGVVFAVEKIINSKLLVPGSNKRLQTIDKHVGVAYSGLLPDGRHFVNRGRDDARSWRDLYKSQI PVSTLADHMGGYAQAYTLYNSVRPFGVTAIVGGVDSKGPHLYMIEPSGTYWGYRGAATGKGRQTATSELEKLDFGSLTAE EAVKEAAKIIYLAHEDSKDKDFELEISWVSTSATGGVHQYVPEALLEEAKQYAINEIEGDDGDEMEE
GO term prediction
Biological Process
GO:0051603 proteolysis involved in cellular protein catabolic process
Molecular Function
GO:0004298 threonine-type endopeptidase activity
Cellular Component
GO:0005839 proteasome core complex