Protein

MCA_02053_1

Length
263 amino acids

Browser: contigB:107432-108431-

RNA-seq: read pairs 4456, FPKM 208.6, percentile rank 88.5% (100% = highest expression)

Protein function

KEGG:K02727PSMA3 20S proteasome subunit alpha 7 [EC:3.4.25.1]
EGGNOG:0PGK8FG00564.1The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000005889PRE10Probable proteasome subunit alpha type-7
CGD closest match:CAL0000177938PRE10Proteasome endopeptidase complex

Protein alignments

%idAln lengthE-value
A0A0J9XC06_GEOCN84.52%2396e-147Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA09s03585g PE=3 SV=1
A0A060TC35_BLAAD82.01%2392e-141Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B19888g PE=3 SV=1
A0A1E3PN21_9ASCO75.73%2397e-132Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82538 PE=3 SV=1
MIA_05556_185.85%2127e-127MIA_05556_1
Q6C2J2_YARLI73.22%2393e-126Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F07469g PE=3 SV=1
UniRef50_B8N2L965.43%2693e-112Proteasome subunit alpha type n=249 Tax=Fungi TaxID=4751 RepID=B8N2L9_ASPFN
PSA7_YEAST69.46%2393e-115Probable proteasome subunit alpha type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE10 PE=1 SV=2
A0A1D8PQW1_CANAL67.08%2403e-114Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE10 PE=3 SV=1
A0A1E4TFJ1_9ASCO64.29%2383e-108Proteasome endopeptidase complex OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31463 PE=3 SV=1
A0A167F7Z8_9ASCO82.22%903e-41Proteasome core particle subunit alpha 7 OS=Sugiyamaella lignohabitans GN=PRE10 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0675
Predicted cleavage: 13

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 263

Detailed signature matches

  1. Family IPR001353
    Proteasome, subunit alpha/beta
    1. PF00227 (Proteasome)
  2. Family IPR023332
    Proteasome alpha-type subunit
    1. PS51475 (PROTEASOME...)
  3. Domain IPR029055
    Nucleophile aminohydrolases, N-terminal
    1. G3DSA:3.60.20.10
    2. SSF56235 (N-termina...)
  4. Domain IPR000426
    Proteasome alpha-subunit, N-terminal domain
    1. PS00388 (PROTEASOME...)
    2. PF10584 (Proteasome...)
    3. SM00948 (Proteasome...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd03751 (proteasome...)

Residue annotation

  1. alpha subunit inte...
  2. active site cd03751

Protein sequence

>MCA_02053_1
MVRFFTSIGTGYDLSNSTFSPDGRNFQVEYAVKAVENSGTSIGIRCKDGVVLAVEKIITSKLLVPGANKRLQSIDKHIGA
AYSGLLPDGRHFVNRGRSDAKSWRDVYKSPIPVPSLANYVGGYAQAYTLYNSVRPFGITAIIGGVDEDGPHLYMIEPSGT
CWGYLGAATGKGRQTASSELEKLDLGSLSAEEAVKEAAKIIYLAHEDSKDKDFELEISWVSTSATGGVHQYVPKELLEEA
KQYAANAVAGNNDEENNEDRMEE

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex