Protein

MIA_05551_1

Length
432 amino acids

Browser: contig08:794127-795478+

Protein function

EGGNOG:0PGVEFG09421.1cell division control protein 11
SGD closest match:S000003837CDC11Cell division control protein 11
CGD closest match:CAL0000186883SEP7Septation protein 7

Protein alignments

%idAln lengthE-value
MCA_02079_145.67%3353e-99MCA_02079_1
A0A0J9XKR7_GEOCN57.38%1831e-72Similar to Saccharomyces cerevisiae YJR076C CDC11 Component of the septin ring of the mother-bud neck that is required for cytokinesis OS=Geotrichum candidum GN=BN980_GECA32s00901g PE=3 SV=1
UniRef50_A0A0J9XKR757.38%1832e-69Similar to Saccharomyces cerevisiae YJR076C CDC11 Component of the septin ring of the mother-bud neck that is required for cytokinesis n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XKR7_GEOCN
A0A060T224_BLAAD54.95%1825e-62ARAD1C21648p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C21648g PE=3 SV=1
A0A167EFG5_9ASCO51.65%1827e-59Septin CDC11 OS=Sugiyamaella lignohabitans GN=CDC11 PE=3 SV=1
A0A1E4TMB6_9ASCO50.00%1822e-59Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_95192 PE=3 SV=1
Q6C5I6_YARLI49.18%1834e-58YALI0E17765p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E17765g PE=3 SV=2
A0A1E3PK70_9ASCO45.88%1942e-55Septin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82687 PE=3 SV=1
CDC11_YEAST47.42%1946e-55Cell division control protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC11 PE=1 SV=1
SHS1_CANAL43.27%2082e-46Septation protein 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEP7 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3665
Predicted cleavage: 21

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 432

Detailed signature matches

  1. Family IPR016491
    Septin
    1. cd01850 (CDC_Septin)
    2. PIRSF006698 (Septin)
  2. Domain IPR030379
    Septin-type guanine nucleotide-binding (G) domain
    1. PF00735 (Septin)
    2. PS51719 (G_SEPTIN)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...
  3. mobidb-lite (disord...)

Residue annotation

  1. G1 box cd01850
  2. GTP/Mg2+ binding s...
  3. Switch I region cd...
  4. G2 box cd01850
  5. G3 box cd01850
  6. Switch II region c...
  7. G4 box cd01850
  8. G5 box cd01850

Protein sequence

>MIA_05551_1
MLCGESGSGKSSFVNTLCRTNVIAPLDMLNNLPPHPETAHLDAGLRLDAMTVEIPDQGDGVLTLNIIDPVGFGQNLDNGP
VFDEIVNYVEKQFDSVLAEESRIRRNPRFTDTRVHAILYFIQPTGHGLREPDIDFLQRLSPKANVIPVLAKADGLTAPEL
QLNKRLVMEDIRRLRIPVYGFPGGDGFQYEEVANGSKKSGPQSNGNSRRNSRMGVYDDLFEEDVLVDSEAEDEEVEEGRE
EEEDEDEDEFARVSRQAKKMVPFAVVGASDIDEHQGLLTRRYAWGAVDVEDARVSNVGLLRTVLTRTHVRDLRDTTEYVL
YENYRTQKLSHELAEEGVSEAGGEEERSEASVVVGGDEAGGALLEREQQIWASEQRLKDTESKLARDVAARRAEIAAQEQ
ELKRLELELLSKAAAMSLGRGRAAGSSQSIGY

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005525 GTP binding

Cellular Component

None predicted.