Protein

MCA_02079_1

Length
447 amino acids

Gene name: CDC11B

Description: Cell division control protein 11; septin

Browser: contigB:177981-179849+

RNA-seq: read pairs 3428, FPKM 94.5, percentile rank 77.7% (100% = highest expression)

Protein function

Annotation:CDC11BCell division control protein 11; septin
KEGG:K16945CDC11 cell division control protein 11
EGGNOG:0PGVEFG09421.1cell division control protein 11
SGD closest match:S000003837CDC11Cell division control protein 11
CGD closest match:CAL0000186883SEP7Septation protein 7

Protein alignments

%idAln lengthE-value
A0A0J9XKR7_GEOCN59.90%4049e-170Similar to Saccharomyces cerevisiae YJR076C CDC11 Component of the septin ring of the mother-bud neck that is required for cytokinesis OS=Geotrichum candidum GN=BN980_GECA32s00901g PE=3 SV=1
UniRef50_A0A0J9XKR759.90%4042e-166Similar to Saccharomyces cerevisiae YJR076C CDC11 Component of the septin ring of the mother-bud neck that is required for cytokinesis n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XKR7_GEOCN
A0A060T224_BLAAD49.63%4073e-121ARAD1C21648p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C21648g PE=3 SV=1
A0A1E3PK70_9ASCO44.01%4096e-108Septin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82687 PE=3 SV=1
MIA_02863_141.57%4212e-104MIA_02863_1
Q6CD10_YARLI41.71%4101e-105YALI0C04774p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C04774g PE=3 SV=2
CDC11_YEAST42.23%4127e-99Cell division control protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC11 PE=1 SV=1
A0A167EFG5_9ASCO44.22%3983e-96Septin CDC11 OS=Sugiyamaella lignohabitans GN=CDC11 PE=3 SV=1
A0A1E4TMB6_9ASCO45.62%3201e-96Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_95192 PE=3 SV=1
SHS1_CANAL39.39%3632e-76Septation protein 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEP7 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6745

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 447

Detailed signature matches

  1. Family IPR016491
    Septin
    1. cd01850 (CDC_Septin)
    2. PIRSF006698 (Septin)
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR030379
    Septin-type guanine nucleotide-binding (G) domain
    1. PF00735 (Septin)
    2. PS51719 (G_SEPTIN)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...
  3. mobidb-lite (disord...)

Residue annotation

  1. G1 box cd01850
  2. GTP/Mg2+ binding s...
  3. Switch I region cd...
  4. G2 box cd01850
  5. G3 box cd01850
  6. Switch II region c...
  7. G4 box cd01850
  8. G5 box cd01850

Protein sequence

>MCA_02079_1
MANPIPTPAMLRHRKTQKKGIKFTIMLCGSGGCGKSSFINTLCQQQVLSPAEMLANIPSSYNAEKDPGLDIVSLNVELPD
EGNGILSIKFIDTPGFGDNLDNSASFTEIVNYICKQYDDVLAEESRIRRNPRFVDNRVHALVYFITATGHGLREQDVEFM
KLMSTKVNVIPVIAKSDSLTVEELELNKDLIIQDLKHYNIPIYGFPGVDNLKGQSFFTNEEENDYDANDTDSIIDDEFIE
LNKYIRAKVPFAVIGASEIIETADKQIQARRYPWGVLDVNNPEYSDMELLRDILTRTHLSDLKETTHFILYENYRTEKLS
RDLPSASPSPMIKQQSTMEGASNGLGVASPRPPYTSQILGGSTTTVNTSDVTGEEVSSEHNNSILLREEQLRANEEKLRQ
IENKVQNEILQKRQELLNRERELKELELKLKTETENLRERDRSIPAM

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005525 GTP binding

Cellular Component

None predicted.