Protein
MIA_05499_1
Length
113 amino acids
Browser: contig08:652798-653140-
Protein function
| EGGNOG: | 0PRUP | NHP6 | DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex |
|---|---|---|---|
| SGD closest match: | S000002157 | NHP6B | Non-histone chromosomal protein 6B |
| CGD closest match: | CAL0000201490 | NHP6 | Non-histone chromosomal protein 6 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A060SYZ3_BLAAD | 70.423% | 71 | 8.40e-32 | ARAD1A15532p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A15532g PE=4 SV=1 |
| UniRef50_A0A060SYZ3 | 70.423% | 71 | 2.07e-28 | ARAD1A15532p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SYZ3_BLAAD |
| A0A167EYL2_9ASCO | 59.459% | 111 | 1.10e-31 | Nhp6bp OS=Sugiyamaella lignohabitans GN=NHP6B PE=4 SV=1 |
| NHP6B_YEAST | 69.697% | 66 | 3.83e-31 | Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6B PE=1 SV=3 |
| NHP6_CANAL | 75.758% | 66 | 6.86e-31 | Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NHP6 PE=3 SV=1 |
| A0A0J9X4V4_GEOCN | 63.158% | 76 | 8.28e-31 | Similar to Saccharomyces cerevisiae YBR089C-A NHP6B High-mobility group (HMG) protein, binds to and remodels nucleosomes OS=Geotrichum candidum GN=BN980_GECA02s06335g PE=4 SV=1 |
| A0A1E3PEI4_9ASCO | 62.338% | 77 | 1.25e-30 | Non-histone chromosomal protein 6 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_28285 PE=4 SV=1 |
| NHP6_YARLI | 66.667% | 69 | 6.17e-30 | Non-histone chromosomal protein 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NHP6 PE=3 SV=1 |
| A0A1E4THC9_9ASCO | 68.182% | 66 | 1.65e-29 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31873 PE=4 SV=1 |
| MCA_00437_1 | 61.538% | 78 | 4.18e-28 | MCA_00437_1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0167
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
20
40
60
80
100
113
Detailed signature matches
no IPR
Unintegrated signatures
-
-
PR00886 (HIGHMOBLTY12)
-
cd01390 (HMGB-UBF_H...)
-
mobidb-lite (disord...)
Residue annotation
-
DNA binding site c...
Protein sequence
>MIA_05499_1 MPKEGSGRRRKDDLDGAAAPAPTKKGKKKDPNAPKRSLSAYMFFANEKRDEVRNENPGISFGQIGKVLGEKWKALSDEEK QPYNDKAETDKKRYEAEMTLYKNNKQGVYAEPE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.