Protein
MIA_05452_1
Length
121 amino acids
Browser: contig08:511169-511670+
Protein function
| EGGNOG: | 0PQRY | cytochrome c oxidase assembly protein | |
|---|---|---|---|
| SGD closest match: | S000003795 | PET191 | Mitochondrial protein PET191 |
| CGD closest match: | CAL0000175914 | orf19.5394.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00747_1 | 79.66% | 118 | 4e-68 | MCA_00747_1 |
| A0A0J9X492_GEOCN | 86.87% | 99 | 6e-62 | Similar to Saccharomyces cerevisiae YJR034W PET191 Protein required for assembly of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA02s03409g PE=4 SV=1 |
| A0A060T3B2_BLAAD | 67.68% | 99 | 2e-48 | ARAD1C35860p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C35860g PE=4 SV=1 |
| A0A1E4TK08_9ASCO | 62.24% | 98 | 2e-41 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_42700 PE=4 SV=1 |
| A0A1D8PIZ2_CANAL | 57.43% | 101 | 4e-41 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5394.1 PE=4 SV=1 |
| Q6CBP6_YARLI | 58.95% | 95 | 2e-39 | YALI0C16731p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C16731g PE=4 SV=1 |
| UniRef50_Q6CBP6 | 58.95% | 95 | 5e-36 | YALI0C16731p n=6 Tax=Saccharomycetales TaxID=4892 RepID=Q6CBP6_YARLI |
| PT191_YEAST | 58.00% | 100 | 8e-39 | Mitochondrial protein PET191 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET191 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0139
Protein family membership
- Cytochrome c oxidase assembly protein PET191 (IPR018793)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_05452_1 MPSSCKDLKNAVAICLQRSPCVMIDRNTPKQCIETEELRRELPEKCRLQLASFYKCKHGLVDMRKRFRGNAPLSTGRYDA ELARLSSGNFNPEEEQAKLETPLTAKSHASGIKPSDRTREA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.