Protein
MCA_00747_1
Length
120 amino acids
Gene name: PET191
Description: Mitochondrial protein PET191; cytochrome c oxidase assembly factor 5
Browser: contigA:2327287-2327785-
RNA-seq: read pairs 1039, FPKM 106.1, percentile rank 79.8% (100% = highest expression)
Protein function
Annotation: | PET191 | Mitochondrial protein PET191; cytochrome c oxidase assembly factor 5 | |
---|---|---|---|
KEGG: | K18178 | COA5 | cytochrome c oxidase assembly factor 5 |
EGGNOG: | 0PQRY | cytochrome c oxidase assembly protein | |
SGD closest match: | S000003795 | PET191 | Mitochondrial protein PET191 |
CGD closest match: | CAL0000175914 | orf19.5394.1 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05452_1 | 79.66% | 118 | 4e-68 | MIA_05452_1 |
A0A0J9X492_GEOCN | 82.83% | 99 | 6e-59 | Similar to Saccharomyces cerevisiae YJR034W PET191 Protein required for assembly of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA02s03409g PE=4 SV=1 |
A0A060T3B2_BLAAD | 68.69% | 99 | 2e-49 | ARAD1C35860p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C35860g PE=4 SV=1 |
A0A1E4TK08_9ASCO | 65.05% | 103 | 5e-46 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_42700 PE=4 SV=1 |
A0A1D8PIZ2_CANAL | 61.62% | 99 | 7e-44 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5394.1 PE=4 SV=1 |
PT191_YEAST | 59.05% | 105 | 8e-42 | Mitochondrial protein PET191 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET191 PE=1 SV=1 |
UniRef50_Q02772 | 59.05% | 105 | 2e-38 | Mitochondrial protein PET191 n=86 Tax=Saccharomycetales TaxID=4892 RepID=PT191_YEAST |
Q6CBP6_YARLI | 58.95% | 95 | 2e-39 | YALI0C16731p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C16731g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0182
Protein family membership
- Cytochrome c oxidase assembly protein PET191 (IPR018793)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_00747_1 MPSSCKDLKNSVAICLQRSPCVMIDRHTPKECIENDELRKELPEKCRLQLMSFYKCKHGLVDMRKRFRGNAPISTGRYDA ELAKLSSGNFDPEEEQRKLRSFVSEDHASGVNPSQKSESS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.