MIA_05423_1

Browser: contig08:416309-417104+

Protein function

EGGNOG:	0PQ3R	PGUG_00135	mitochondrial inner membrane protein
SGD closest match:	S000001419	COA1	Cytochrome c oxidase assembly factor 1
CGD closest match:	CAL0000190031	orf19.5296	Uncharacterized protein

Protein alignments

	%id	Aln length	E-value
MCA_05161_1	71.053%	190	4.04e-99	MCA_05161_1
A0A0J9X7J3_GEOCN	57.647%	170	9.63e-64	Similar to Saccharomyces cerevisiae YIL157C COA1 Mitochondrial inner membrane protein required for assembly of the cytochrome c oxidase complex (Complex IV) OS=Geotrichum candidum GN=BN980_GECA04s05730g PE=4 SV=1
UniRef50_A0A0J9X7J3	57.647%	170	1.97e-60	Similar to Saccharomyces cerevisiae YIL157C COA1 Mitochondrial inner membrane protein required for assembly of the cytochrome c oxidase complex (Complex IV) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7J3_GEOCN
A0A060T9M3_BLAAD	51.351%	148	1.28e-46	ARAD1B00242p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B00242g PE=4 SV=1
A0A167FVQ6_9ASCO	40.625%	192	3.19e-42	Coa1p OS=Sugiyamaella lignohabitans GN=COA1 PE=4 SV=1
A0A1E3PEQ9_9ASCO	38.655%	119	7.94e-23	DUF1783-domain-containing protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_12912 PE=4 SV=1
COA1_YEAST	30.247%	162	6.75e-22	Cytochrome c oxidase assembly factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA1 PE=1 SV=1
Q6C280_YARLI	34.247%	146	4.55e-21	YALI0F10054p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F10054g PE=4 SV=1
Q5A5V4_CANAL	30.769%	130	1.83e-18	Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5296 PE=4 SV=1
A0A1E4TIM3_9ASCO	36.975%	119	2.67e-19	Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13822 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9725
Predicted cleavage: 41

Protein family membership

Domains and repeats

Detailed signature matches

Protein sequence

>MIA_05423_1
MSLRYSLLKSQRLLGVSPLAGRVALARLYSSSPSFSSNRNTPKSESTAAAASSSFGDKFRTPESFDEINIKPTKAIHEHI
SKQYPNPIDNPENHDYFFDENGNRRVTIHSDDLPDPLAETRRNKRSFYAFVAFMLITFGGIVKYEDANSPVVTSTLYTLR
RSARARQLLGDNISFYSLFPWITGYISTIGGAVDFKYTIKGSKVPKAIVWFKAEKSQETNRFVVTEWSVTPENGETMSLL
DEEYMPFIPLKNEEATSRHRSENY

GO term prediction