Protein
MIA_05423_1
Length
264 amino acids
Browser: contig08:416309-417104+
Protein function
EGGNOG: | 0PQ3R | PGUG_00135 | mitochondrial inner membrane protein |
---|---|---|---|
SGD closest match: | S000001419 | COA1 | Cytochrome c oxidase assembly factor 1 |
CGD closest match: | CAL0000190031 | orf19.5296 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_05161_1 | 71.053% | 190 | 4.04e-99 | MCA_05161_1 |
A0A0J9X7J3_GEOCN | 57.647% | 170 | 9.63e-64 | Similar to Saccharomyces cerevisiae YIL157C COA1 Mitochondrial inner membrane protein required for assembly of the cytochrome c oxidase complex (Complex IV) OS=Geotrichum candidum GN=BN980_GECA04s05730g PE=4 SV=1 |
UniRef50_A0A0J9X7J3 | 57.647% | 170 | 1.97e-60 | Similar to Saccharomyces cerevisiae YIL157C COA1 Mitochondrial inner membrane protein required for assembly of the cytochrome c oxidase complex (Complex IV) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7J3_GEOCN |
A0A060T9M3_BLAAD | 51.351% | 148 | 1.28e-46 | ARAD1B00242p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B00242g PE=4 SV=1 |
A0A167FVQ6_9ASCO | 40.625% | 192 | 3.19e-42 | Coa1p OS=Sugiyamaella lignohabitans GN=COA1 PE=4 SV=1 |
A0A1E3PEQ9_9ASCO | 38.655% | 119 | 7.94e-23 | DUF1783-domain-containing protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_12912 PE=4 SV=1 |
COA1_YEAST | 30.247% | 162 | 6.75e-22 | Cytochrome c oxidase assembly factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA1 PE=1 SV=1 |
Q6C280_YARLI | 34.247% | 146 | 4.55e-21 | YALI0F10054p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F10054g PE=4 SV=1 |
Q5A5V4_CANAL | 30.769% | 130 | 1.83e-18 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5296 PE=4 SV=1 |
A0A1E4TIM3_9ASCO | 36.975% | 119 | 2.67e-19 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13822 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9725
Predicted cleavage: 41
Protein family membership
- Cytochrome oxidase assembly protein 1 (IPR014807)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_05423_1 MSLRYSLLKSQRLLGVSPLAGRVALARLYSSSPSFSSNRNTPKSESTAAAASSSFGDKFRTPESFDEINIKPTKAIHEHI SKQYPNPIDNPENHDYFFDENGNRRVTIHSDDLPDPLAETRRNKRSFYAFVAFMLITFGGIVKYEDANSPVVTSTLYTLR RSARARQLLGDNISFYSLFPWITGYISTIGGAVDFKYTIKGSKVPKAIVWFKAEKSQETNRFVVTEWSVTPENGETMSLL DEEYMPFIPLKNEEATSRHRSENY
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.