MCA_05161_1

Gene name: COA1

Description: Cytochrome c oxidase assembly factor 1

Browser: contigD:501119-501881+

RNA-seq: read pairs 2429, FPKM 118.2, percentile rank 81.6% (100% = highest expression)

Protein function

Annotation:		COA1	Cytochrome c oxidase assembly factor 1
KEGG:	K18173	COA1	cytochrome c oxidase assembly factor 1
EGGNOG:	0PQ3R	PGUG_00135	mitochondrial inner membrane protein
SGD closest match:	S000001419	COA1	Cytochrome c oxidase assembly factor 1
CGD closest match:	CAL0000190031	orf19.5296	Uncharacterized protein

Protein alignments

	%id	Aln length	E-value
MIA_05423_1	67.82%	202	4e-98	MIA_05423_1
A0A0J9X7J3_GEOCN	62.35%	170	1e-75	Similar to Saccharomyces cerevisiae YIL157C COA1 Mitochondrial inner membrane protein required for assembly of the cytochrome c oxidase complex (Complex IV) OS=Geotrichum candidum GN=BN980_GECA04s05730g PE=4 SV=1
UniRef50_A0A0J9X7J3	62.35%	170	2e-72	Similar to Saccharomyces cerevisiae YIL157C COA1 Mitochondrial inner membrane protein required for assembly of the cytochrome c oxidase complex (Complex IV) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7J3_GEOCN
A0A167FVQ6_9ASCO	48.08%	156	2e-45	Coa1p OS=Sugiyamaella lignohabitans GN=COA1 PE=4 SV=1
A0A060T9M3_BLAAD	45.45%	154	1e-43	ARAD1B00242p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B00242g PE=4 SV=1
COA1_YEAST	33.83%	133	1e-24	Cytochrome c oxidase assembly factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA1 PE=1 SV=1
Q5A5V4_CANAL	35.82%	134	1e-22	Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5296 PE=4 SV=1
A0A1E3PEQ9_9ASCO	39.37%	127	1e-22	DUF1783-domain-containing protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_12912 PE=4 SV=1
Q6C280_YARLI	34.72%	144	6e-20	YALI0F10054p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F10054g PE=4 SV=1
A0A1E4TIM3_9ASCO	35.83%	120	1e-20	Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13822 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9972
Predicted cleavage: 35

Protein family membership

Domains and repeats

Detailed signature matches

Protein sequence

>MCA_05161_1
MFRLSRSLLQSKPVLSRRLTCNSIRQISSQFRLLQTYKTIPSTKALYSTTTTSSSNAVGKENTKDIHEHMSKEYENPIDD
PANHDYFFTEDGKRRVTIHDEDFPDPLAEKRMHRRAFIAFVVLMLTTVAGIVKYEDANSPVVTSTLYTLRRSEKARALLG
DNISFVSLFPWISGVISTVNGNVEFSYHVKGSKVKNAVVRFKAVKSPTTGKFTVEDWSVTPQGQETLSLLDEEYMPFIPK
KNEEATSKHKSEL

GO term prediction