Protein

MCA_05161_1

Length
253 amino acids


Gene name: COA1

Description: Cytochrome c oxidase assembly factor 1

Browser: contigD:501119-501881+

RNA-seq: read pairs 2429, FPKM 118.2, percentile rank 81.6% (100% = highest expression)

Protein function

Annotation:COA1Cytochrome c oxidase assembly factor 1
KEGG:K18173COA1 cytochrome c oxidase assembly factor 1
EGGNOG:0PQ3RPGUG_00135mitochondrial inner membrane protein
SGD closest match:S000001419COA1Cytochrome c oxidase assembly factor 1
CGD closest match:CAL0000190031orf19.5296Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_05423_167.82%2024e-98MIA_05423_1
A0A0J9X7J3_GEOCN62.35%1701e-75Similar to Saccharomyces cerevisiae YIL157C COA1 Mitochondrial inner membrane protein required for assembly of the cytochrome c oxidase complex (Complex IV) OS=Geotrichum candidum GN=BN980_GECA04s05730g PE=4 SV=1
UniRef50_A0A0J9X7J362.35%1702e-72Similar to Saccharomyces cerevisiae YIL157C COA1 Mitochondrial inner membrane protein required for assembly of the cytochrome c oxidase complex (Complex IV) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7J3_GEOCN
A0A167FVQ6_9ASCO48.08%1562e-45Coa1p OS=Sugiyamaella lignohabitans GN=COA1 PE=4 SV=1
A0A060T9M3_BLAAD45.45%1541e-43ARAD1B00242p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B00242g PE=4 SV=1
COA1_YEAST33.83%1331e-24Cytochrome c oxidase assembly factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA1 PE=1 SV=1
Q5A5V4_CANAL35.82%1341e-22Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5296 PE=4 SV=1
A0A1E3PEQ9_9ASCO39.37%1271e-22DUF1783-domain-containing protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_12912 PE=4 SV=1
Q6C280_YARLI34.72%1446e-20YALI0F10054p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F10054g PE=4 SV=1
A0A1E4TIM3_9ASCO35.83%1201e-20Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13822 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9972
Predicted cleavage: 35

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_05161_1
MFRLSRSLLQSKPVLSRRLTCNSIRQISSQFRLLQTYKTIPSTKALYSTTTTSSSNAVGKENTKDIHEHMSKEYENPIDD
PANHDYFFTEDGKRRVTIHDEDFPDPLAEKRMHRRAFIAFVVLMLTTVAGIVKYEDANSPVVTSTLYTLRRSEKARALLG
DNISFVSLFPWISGVISTVNGNVEFSYHVKGSKVKNAVVRFKAVKSPTTGKFTVEDWSVTPQGQETLSLLDEEYMPFIPK
KNEEATSKHKSEL

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.