Protein
MIA_05411_1
Length
432 amino acids
Browser: contig08:378077-379376-
Protein function
| EGGNOG: | 0PISS | SFH1 | of the chromatin structure-remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA. The reaction requires ATP and involves an activated RSC-nucleosome intermediate. Remodeling reaction also involves DNA translocation, DNA twist and conformational change. As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton. This subunit is essential for mitotic growth and required for cell cycle progression |
|---|---|---|---|
| SGD closest match: | S000004313 | SFH1 | Chromatin structure-remodeling complex subunit SFH1 |
| CGD closest match: | CAL0000186865 | orf19.5093 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A060TCN0_BLAAD | 46.727% | 443 | 4.67e-94 | ARAD1D00902p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D00902g PE=4 SV=1 |
| A0A167CQ83_9ASCO | 47.113% | 433 | 3.22e-93 | Sfh1p OS=Sugiyamaella lignohabitans GN=SFH1 PE=4 SV=1 |
| A0A0J9X2K0_GEOCN | 54.605% | 304 | 4.27e-87 | Similar to Saccharomyces cerevisiae YLR321C SFH1 Component of the RSC chromatin remodeling complex OS=Geotrichum candidum GN=BN980_GECA01s02881g PE=4 SV=1 |
| A0A1E3PPX8_9ASCO | 54.015% | 274 | 5.58e-72 | SNF5-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_72993 PE=4 SV=1 |
| UniRef50_A0A1E3PWU1 | 44.762% | 315 | 1.33e-66 | Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3PWU1_LIPST |
| SFH1_YARLI | 36.175% | 434 | 1.32e-54 | Chromatin structure-remodeling complex subunit SFH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SFH1 PE=3 SV=1 |
| MCA_06077_1 | 55.422% | 166 | 4.57e-51 | MCA_06077_1 |
| A0A1E4TCN0_9ASCO | 39.935% | 308 | 4.23e-46 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_140214 PE=4 SV=1 |
| SFH1_YEAST | 34.188% | 234 | 5.31e-39 | Chromatin structure-remodeling complex subunit SFH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFH1 PE=1 SV=1 |
| A0A1D8PEB6_CANAL | 36.864% | 236 | 1.17e-35 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5093 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9570
Predicted cleavage: 44
Protein family membership
- SNF5/SMARCB1/INI1 (IPR006939)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04855 (SNF5)
-
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_05411_1 MSSTQTLHKLPQALRSGFASRLRLDQTSLFVSTVPVSRANKRSSAAVSYAEIDEDYDEDEDSGRGSVPGTPRLGNGALAG GSGTPGSPAAKGAGANGSGAGGTYYSQPIGDKPENKGFVNPVHVAKLRHMVRYNDVQLREAAAGEEVLVPIRLNLEYDNF RISDSFLWNLNEKVLTPEMFAIVLCQDLELPIAGGPGGIGALGGPVVVETSSLGSTLAQSLAHTNYVNQIASTIHTQLHE YTTFANVKLPEETGFHVIISLSVNLNKQVYEDKFEWDLSNSSSSLTSEQDAGGLTPLEFARTVVQDLGLSGEFYPAIAHA VYESIYRVKKEALDGHLPPQEVENYAAFGLEAGWRVEQEMLGEEWAPSVETLSQEEIEKREIERERNIRRLKRESARMGG SAASAFDGFVDGTGESFGRGKRRRRGESPAWH
GO term prediction
Biological Process
GO:0006338 chromatin remodeling
Molecular Function
None predicted.
Cellular Component
GO:0000228 nuclear chromosome