Protein
MCA_06077_1
Length
454 amino acids
Gene name: SFH1
Description: Chromatin structure-remodeling complex subunit SFH1
Browser: contigD:3182423-3183788+
RNA-seq: read pairs 1186, FPKM 32.2, percentile rank 54.7% (100% = highest expression)
Protein function
| Annotation: | SFH1 | Chromatin structure-remodeling complex subunit SFH1 | |
|---|---|---|---|
| KEGG: | K11770 | SFH1 | chromatin structure-remodeling complex subunit SFH1 |
| EGGNOG: | 0PISS | SFH1 | of the chromatin structure-remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA. The reaction requires ATP and involves an activated RSC-nucleosome intermediate. Remodeling reaction also involves DNA translocation, DNA twist and conformational change. As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton. This subunit is essential for mitotic growth and required for cell cycle progression |
| SGD closest match: | S000004313 | SFH1 | Chromatin structure-remodeling complex subunit SFH1 |
| CGD closest match: | CAL0000186865 | orf19.5093 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X2K0_GEOCN | 47.92% | 265 | 6e-63 | Similar to Saccharomyces cerevisiae YLR321C SFH1 Component of the RSC chromatin remodeling complex OS=Geotrichum candidum GN=BN980_GECA01s02881g PE=4 SV=1 |
| A0A167CQ83_9ASCO | 44.90% | 245 | 2e-51 | Sfh1p OS=Sugiyamaella lignohabitans GN=SFH1 PE=4 SV=1 |
| MIA_05411_1 | 56.69% | 157 | 3e-50 | MIA_05411_1 |
| A0A060TCN0_BLAAD | 44.17% | 240 | 4e-47 | ARAD1D00902p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D00902g PE=4 SV=1 |
| UniRef50_K0K7J8 | 37.40% | 246 | 1e-37 | Chromatin structure-remodeling complex subunit n=7 Tax=Saccharomycetales TaxID=4892 RepID=K0K7J8_WICCF |
| A0A1E3PPX8_9ASCO | 41.74% | 242 | 8e-38 | SNF5-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_72993 PE=4 SV=1 |
| SFH1_YARLI | 36.73% | 245 | 1e-28 | Chromatin structure-remodeling complex subunit SFH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SFH1 PE=3 SV=1 |
| A0A1D8PEB6_CANAL | 32.03% | 256 | 1e-25 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5093 PE=4 SV=1 |
| A0A1E4TCN0_9ASCO | 38.93% | 131 | 4e-20 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_140214 PE=4 SV=1 |
| SFH1_YEAST | 43.02% | 86 | 1e-16 | Chromatin structure-remodeling complex subunit SFH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFH1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5750
Predicted cleavage: 44
Protein family membership
- SNF5/SMARCB1/INI1 (IPR006939)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04855 (SNF5)
-
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_06077_1 MDSQQALIRIPQALKTGFPSRLRLEQTSFFISTTPIIRSNKRAASAVSYAEIDEDFDEDDDEEDLGFRRRSTRSSMNHNG GGAAAQTDEEEEKKVAKPEVKTPLPPASAIMRRVLNYNDVQLRQVAEDEEVLVPIRLNLEYESFRITDCFLWNLNEKVLT PEMFALSLCYDLDLPVPNPNLMMGGAGGPSFGSDSYVAQIAGAIKSQLAEFKTLADIKLPQEQGFNVVISLNVNLNKQVY EDKFEWDLGNGAKSSCYIKDKKKNSNSSNTQALKTENNSTNSTPSDDDNTQKDEPETDESKGSDEEKKEDDKEESTFNGP GLTPIEFAKTIVTDLGFPNEFFPAIAHALYESLYRIKRDALEGHLPPQDVENYAAFNKEAGWRIDQEMLGEEWAPTLETL SQEEIEKREIERERNIRRLKRESLRMGGVILGGDGFSTPDGSKRRRTRGESPLY
GO term prediction
Biological Process
GO:0006338 chromatin remodeling
Molecular Function
None predicted.
Cellular Component
GO:0000228 nuclear chromosome