Protein

MIA_05392_1

Length
206 amino acids


Browser: contig08:326491-327219-

Protein function

SGD closest match:S000004718MED11Mediator of RNA polymerase II transcription subunit 11
CGD closest match:CAL0000188346MED11Mediator of RNA polymerase II transcription subunit 11

Protein alignments

%idAln lengthE-value
MCA_05455_152.066%1213.32e-37MCA_05455_1
A0A0J9XIB0_GEOCN49.533%1071.35e-28Similar to Saccharomyces cerevisiae YMR112C MED11 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA19s00802g PE=4 SV=1
UniRef50_A0A0J9XIB049.533%1072.76e-25Similar to Saccharomyces cerevisiae YMR112C MED11 Subunit of the RNA polymerase II mediator complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIB0_GEOCN
A0A1E3PSQ5_9ASCO41.803%1221.95e-23Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49089 PE=4 SV=1
Q6C590_YARLI33.898%1186.48e-13YALI0E20053p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E20053g PE=4 SV=2
MED11_CANAL33.333%1023.77e-12Mediator of RNA polymerase II transcription subunit 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED11 PE=3 SV=1
MED11_YEAST32.653%981.66e-10Mediator of RNA polymerase II transcription subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED11 PE=1 SV=2
A0A1E4TBJ8_9ASCO30.108%939.86e-07Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_134074 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1172

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_05392_1
MKSNVFENVDLSVAPMARADVEERLDSLHRIDEQIISLLDLASTAIATLRAGKISKEPSAQREFNQATAAYYTELERTSV
ALRREIRLLNDVSGDKVMPVNVVPKATAVGRQKEEAIWLSISEEKKEGGDGDDGSKQGGEKTDGDVEMTDAPKEATNTSP
ADRDPSEAGLEDFVEAAAAAAAAAAGTATEVVSDERQLGKLRLITK

GO term prediction

Biological Process

GO:0006357 regulation of transcription from RNA polymerase II promoter

Molecular Function

GO:0001104 RNA polymerase II transcription cofactor activity

Cellular Component

GO:0016592 mediator complex