Protein
MCA_05455_1
Length
169 amino acids
Browser: contigD:1360405-1360969-
RNA-seq: read pairs 650, FPKM 47.2, percentile rank 64.1% (100% = highest expression)
Protein function
| SGD closest match: | S000004718 | MED11 | Mediator of RNA polymerase II transcription subunit 11 |
|---|---|---|---|
| CGD closest match: | CAL0000188346 | MED11 | Mediator of RNA polymerase II transcription subunit 11 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05392_1 | 44.08% | 152 | 9e-38 | MIA_05392_1 |
| A0A0J9XIB0_GEOCN | 48.67% | 113 | 1e-34 | Similar to Saccharomyces cerevisiae YMR112C MED11 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA19s00802g PE=4 SV=1 |
| UniRef50_A0A0J9XIB0 | 48.67% | 113 | 2e-31 | Similar to Saccharomyces cerevisiae YMR112C MED11 Subunit of the RNA polymerase II mediator complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIB0_GEOCN |
| A0A1E3PSQ5_9ASCO | 42.06% | 126 | 7e-26 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49089 PE=4 SV=1 |
| Q6C590_YARLI | 31.21% | 157 | 2e-15 | YALI0E20053p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E20053g PE=4 SV=2 |
| MED11_YEAST | 36.11% | 108 | 3e-13 | Mediator of RNA polymerase II transcription subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED11 PE=1 SV=2 |
| A0A1E4TBJ8_9ASCO | 32.38% | 105 | 2e-09 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_134074 PE=4 SV=1 |
| MED11_CANAL | 30.19% | 106 | 3e-08 | Mediator of RNA polymerase II transcription subunit 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED11 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0418
Predicted cleavage: 15
Protein family membership
- Mediator complex, subunit Med11 (IPR019404)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_05455_1 MTTNNPNTTQLNRNDTEVFKSPDLTVAPMETKEVQERLESLNKIDKRIIQLLDEASEAIDALKRGKTAQNIVESEQAKRI FSEKVRNYFSQLEETTIDIRKEIRLLNNVSGDKVMPINVVSKAEWMSRRKEEEIWKSLEKMNANLRLAENNTNNKDEKST DNMAMNNEP
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex