Protein

MIA_05384_1

Length
448 amino acids

Browser: contig08:315085-316432-

Protein function

EGGNOG:0PFJUERG9Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol
SGD closest match:S000001233ERG9Squalene synthase
CGD closest match:CAL0000181444ERG9Bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase

Protein alignments

%idAln lengthE-value
MCA_03896_170.404%4460.0MCA_03896_1
A0A0J9X639_GEOCN65.533%4410.0Similar to Saccharomyces cerevisiae YHR190W ERG9 Farnesyl-diphosphate farnesyl transferase (Squalene synthase), joins two farnesyl pyrophosphate moieties to form squalene OS=Geotrichum candidum GN=BN980_GECA02s07996g PE=4 SV=1
A0A060T2L4_BLAAD53.483%4452.42e-172ARAD1C26224p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C26224g PE=4 SV=1
A0A1E3PQP9_9ASCO52.752%4364.30e-170Squalene synthetase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48414 PE=4 SV=1
FDFT_YARLI48.975%4393.61e-157Squalene synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SQS1 PE=3 SV=1
UniRef50_Q9Y75348.975%4398.36e-154Squalene synthase n=15 Tax=Saccharomycetales TaxID=4892 RepID=FDFT_YARLI
A0A1D8PI71_CANAL52.972%3877.53e-148Bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG9 PE=4 SV=1
FDFT_YEAST51.047%3821.62e-139Squalene synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG9 PE=1 SV=2
A0A167CE03_9ASCO50.263%3809.00e-132Bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase OS=Sugiyamaella lignohabitans GN=ERG9 PE=4 SV=1
A0A1E4TDW9_9ASCO47.792%3853.96e-130Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_96812 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0538

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 448

Detailed signature matches

  1. Family IPR002060
    Squalene/phytoene synthase
    1. PF00494 (SQS_PSY)
  2. Family IPR006449
    Farnesyl-diphosphate farnesyltransferase
    1. TIGR01559
  3. Domain IPR008949
    Isoprenoid synthase domain
    1. SSF48576 (Terpenoid...)
    2. G3DSA:1.10.60...
  4. Domain IPR033904
    Trans-Isoprenyl Diphosphate Synthases, head-to-head
    1. cd00683 (Trans_IPPS_HH)
  5. SITE IPR019845
    Squalene/phytoene synthase, conserved site
    1. PS01045 (SQUALEN_PH...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Residue annotation

  1. active site lid re...
  2. substrate binding ...
  3. catalytic residues...
  4. aspartate-rich reg...
  5. substrate-Mg2+ bin...
  6. aspartate-rich reg...

Protein sequence

>MIA_05384_1
MGKLADLLLHPSELRAALQIKFFPAVLYPRKPEQETPELRRCYELLNLTSRSFAAVIQQLHPELRDAIALFYIILRALDT
VEDDMTLPLETKLPLLRKFDTYLTTPGWTFNGSGPDEKDRVVLVEFDVVISEYSNLKPEYREVISDITRRMGAGMADYAI
DSDFTRDGLETIDDYNLYCYYVAGLVGEGLTRMAIISQFGGPILAEEPDLHLAMGLFLQKTNIIRDFKEDLDDGRTFYPK
ELWARHVSSLKELSDPAIYTTKGLHVLTEMTINVLELVPKVLQYLDNINEPTLFRFCAIPQVMAIATLELVFNNVHVFET
NVKIRRGLACKLILLARSRKGVYDVFREYVQRIHDRNVATDPNYLKLEILCGKIEQYIQQHYPKDDNSTLSLAKAHDDSL
DSLMILVAAGGFAVATCAIMVGVAYAFGANFSFSLKDAFPFLADPKLS

GO term prediction

Biological Process

GO:0006696 ergosterol biosynthetic process
GO:0008610 lipid biosynthetic process
GO:0009058 biosynthetic process

Molecular Function

GO:0004310 farnesyl-diphosphate farnesyltransferase activity
GO:0016740 transferase activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0051996 squalene synthase activity

Cellular Component

GO:0016021 integral component of membrane