MCA_03896_1
Gene name: ERG9
Description: Squalene synthase
Browser: contigC:1430667-1432110-
RNA-seq: read pairs 3940, FPKM 101.2, percentile rank 78.9% (100% = highest expression)
Protein function
| Annotation: | ERG9 | Squalene synthase | |
|---|---|---|---|
| KEGG: | K00801 | FDFT1 | farnesyl-diphosphate farnesyltransferase [EC:2.5.1.21] |
| EGGNOG: | 0PFJU | ERG9 | Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol |
| SGD closest match: | S000001233 | ERG9 | Squalene synthase |
| CGD closest match: | CAL0000181444 | ERG9 | Bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05384_1 | 70.40% | 446 | 0.0 | MIA_05384_1 |
| A0A0J9X639_GEOCN | 64.92% | 439 | 0.0 | Similar to Saccharomyces cerevisiae YHR190W ERG9 Farnesyl-diphosphate farnesyl transferase (Squalene synthase), joins two farnesyl pyrophosphate moieties to form squalene OS=Geotrichum candidum GN=BN980_GECA02s07996g PE=4 SV=1 |
| A0A060T2L4_BLAAD | 52.99% | 451 | 2e-169 | ARAD1C26224p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C26224g PE=4 SV=1 |
| A0A1E3PQP9_9ASCO | 53.63% | 427 | 1e-167 | Squalene synthetase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48414 PE=4 SV=1 |
| FDFT_YARLI | 51.72% | 437 | 1e-163 | Squalene synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SQS1 PE=3 SV=1 |
| UniRef50_Q9Y753 | 51.72% | 437 | 3e-160 | Squalene synthase n=15 Tax=Saccharomycetales TaxID=4892 RepID=FDFT_YARLI |
| A0A1D8PI71_CANAL | 51.92% | 391 | 5e-143 | Bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG9 PE=4 SV=1 |
| A0A167CE03_9ASCO | 54.11% | 377 | 4e-140 | Bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase OS=Sugiyamaella lignohabitans GN=ERG9 PE=4 SV=1 |
| FDFT_YEAST | 51.30% | 384 | 2e-137 | Squalene synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG9 PE=1 SV=2 |
| A0A1E4TDW9_9ASCO | 43.84% | 463 | 3e-130 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_96812 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0131
Protein family membership
- Squalene/phytoene synthase (IPR002060)
- Farnesyl-diphosphate farnesyltransferase (IPR006449)
Domains and repeats
-
Domain
Detailed signature matches
no IPR
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
SFLDG01018 (Squalen...)
-
-
TRANSMEMBRANE (Tran...)
Residue annotation
-
active site lid re...
-
substrate binding ...
-
catalytic residues...
-
SFLDG01018
-
aspartate-rich reg...
-
substrate-Mg2+ bin...
-
aspartate-rich reg...
Protein sequence
>MCA_03896_1 MGKITDLLLHPSELLAVFEYKIFPAVLYPREPEKESETLRRCYELLNMTSRSFASVIQQLHPVLRDSIAIFYIVLRALDT IEDDMTLPLDKKIPLLRSFDKNLDTPGWTFTESGPNESDRIVLVEFDTVITEFAKLKPEFQEVIRDITHRMGNGMADYAI DKDFNRDGLETVKDYDLYCYYVAGIVGEGLTRMAIISKFGTPVLADNPELHLAMGLFLQKTNIIRDFREDLDDKRSFYPK ELWSSHVNSLEELLKPEVAAVQGLHILTEMTINALELVPKVLEYLDNIQEPTLYRFCAIPQVMAIASLELVFNNVKVFTQ NVKIRRGLACKLMLQARTKRGVYDVFREYTRKIHRKNVASDPNYLHLEILCGKIEQYIEQHYPEDPMLKAPTVADMQAQS QDGLMVLAFGAFSIVSICSLLVFIAYLMGADFSMTTRDFSDHLKDIFLGQPIDRRTFIQTTATAVESAVETAVKSFKDEL
GO term prediction
Biological Process
GO:0006696 ergosterol biosynthetic process
GO:0008610 lipid biosynthetic process
GO:0009058 biosynthetic process
Molecular Function
GO:0004310 farnesyl-diphosphate farnesyltransferase activity
GO:0016740 transferase activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0051996 squalene synthase activity
Cellular Component
GO:0016021 integral component of membrane