Protein

MIA_05317_1

Length
250 amino acids


Browser: contig08:119410-120163-

Protein function

EGGNOG:0PGWVRPS340s ribosomal protein s3
SGD closest match:S000005122RPS340S ribosomal protein S3
CGD closest match:CAL0000200765RPS3Ribosomal 40S subunit protein S3

Protein alignments

%idAln lengthE-value
MCA_02562_186.026%2299.74e-148MCA_02562_1
A0A0J9XDH4_GEOCN82.533%2297.53e-141Similar to Saccharomyces cerevisiae YNL178W RPS3 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA10s03255g PE=3 SV=1
A0A167CIL4_9ASCO80.349%2291.57e-135Ribosomal 40S subunit protein S3 OS=Sugiyamaella lignohabitans GN=RPS3 PE=3 SV=1
A0A060SZS8_BLAAD79.565%2301.26e-133ARAD1C10890p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C10890g PE=3 SV=1
Q6C4U1_YARLI76.957%2307.42e-126YALI0E23694p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E23694g PE=3 SV=1
A0A1E3PDP6_9ASCO76.419%2291.50e-122Ribosomal protein S3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84484 PE=3 SV=1
UniRef50_F2PKJ970.815%2334.42e-11340S ribosomal protein S3 n=8 Tax=Trichophyton TaxID=5550 RepID=F2PKJ9_TRIEC
RS3_YEAST74.222%2251.29e-11440S ribosomal protein S3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS3 PE=1 SV=5
A0A1D8PSV5_CANAL65.929%2266.11e-102Ribosomal 40S subunit protein S3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS3 PE=4 SV=1
A0A1E4TAQ0_9ASCO62.555%2272.81e-102Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128667 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1597
Predicted cleavage: 12

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 250 250

Detailed signature matches

    1. SSF54814 (Prokaryot...)
    1. PS50823 (KH_TYPE_2)
    2. PF07650 (KH_2)
    1. PF00189 (Ribosomal_...)
    2. SSF54821 (Ribosomal...)
    1. PS00548 (RIBOSOMAL_S3)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd02413 (40S_S3_KH)

Residue annotation

  1. G-X-X-G motif cd02...

Protein sequence

>MIA_05317_1
MSATIISKKRKHVADGVFYAELNEFFTRELSEEGYSGIEVRTTPNKTEIIIRATHTQEVLGPQGRRIRELTTLVRKRFGL
KEEALALYAERVQQRGLSAIAQCESLKYKLLNNLAIRRAAYGVVRYVMESGAKGVEVVVSGKLRAARAKSMKFGAGFMIH
SGQPVRDFIDTATRHVQLKQGMLGVKVKIMRDPAAEAKFGSPKSTLPDTVVIHPPKEEAAPTEPSVITYNVEEPEAAAPV
AEEPVAAASQ

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome
GO:0015935 small ribosomal subunit