Protein

MCA_02562_1

Length
245 amino acids

Gene name: RPS3

Description: 40S ribosomal protein S3

Browser: contigB:1662139-1662877+

RNA-seq: read pairs 64032, FPKM 3216.2, percentile rank 98.6% (100% = highest expression)

Protein function

Annotation:RPS340S ribosomal protein S3
KEGG:K02985RP-S3e small subunit ribosomal protein S3e
EGGNOG:0PGWVRPS340s ribosomal protein s3
SGD closest match:S000005122RPS340S ribosomal protein S3
CGD closest match:CAL0000200765RPS3Ribosomal 40S subunit protein S3

Protein alignments

%idAln lengthE-value
MIA_05317_183.06%2488e-148MIA_05317_1
A0A0J9XDH4_GEOCN79.75%2427e-138Similar to Saccharomyces cerevisiae YNL178W RPS3 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA10s03255g PE=3 SV=1
A0A167CIL4_9ASCO76.62%2317e-128Ribosomal 40S subunit protein S3 OS=Sugiyamaella lignohabitans GN=RPS3 PE=3 SV=1
A0A060SZS8_BLAAD76.96%2305e-126ARAD1C10890p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C10890g PE=3 SV=1
Q6C4U1_YARLI76.19%2315e-125YALI0E23694p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E23694g PE=3 SV=1
A0A1E3PDP6_9ASCO74.55%2242e-117Ribosomal protein S3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84484 PE=3 SV=1
UniRef50_I7ZLD172.32%2241e-11340S ribosomal protein n=4 Tax=Aspergillus TaxID=5052 RepID=I7ZLD1_ASPO3
RS3_YEAST71.55%2393e-11640S ribosomal protein S3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS3 PE=1 SV=5
A0A1E4TAQ0_9ASCO62.60%2462e-103Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128667 PE=3 SV=1
A0A1D8PSV5_CANAL61.83%2412e-99Ribosomal 40S subunit protein S3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS3 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0746
Predicted cleavage: 12

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 245

Detailed signature matches

  1. Family IPR005703
    Ribosomal protein S3, eukaryotic/archaeal
    1. TIGR01008
  2. Domain IPR015946
    K homology domain-like, alpha/beta
    1. G3DSA:3.30.30...
  3. Domain IPR009019
    K homology domain, prokaryotic type
    1. SSF54814 (Prokaryot...)
  4. Domain IPR004044
    K Homology domain, type 2
    1. PS50823 (KH_TYPE_2)
    2. PF07650 (KH_2)
  5. Domain IPR001351
    Ribosomal protein S3, C-terminal
    1. PF00189 (Ribosomal_...)
    2. SSF54821 (Ribosomal...)
  6. SITE IPR018280
    Ribosomal protein S3, conserved site
    1. PS00548 (RIBOSOMAL_S3)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.11...
  2. cd02413 (40S_S3_KH)

Residue annotation

  1. G-X-X-G motif cd02...

Protein sequence

>MCA_02562_1
MSNQPISKKRKHVADGVFYAELNEFFTRELSEEGYSGIEVRNTPNKTEIIIRATHTQEVLGPQGRRIRELTSLVKKRFAL
KEDSISMFAERVAQRGLSATAQCESIKYKLLNNLAIRRAAYGVVRFVMESGAKGVEVVVSGKLRAARAKSMKFGAGFMIH
SGQPVKDFIDTATRHVQLKQGMLGVKVKIMRDPAKEAAAGTPKSTLPDNVIIHPPKEDKPVSEPFVHSYIAKPEPEVQAE
PVAAQ

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome
GO:0015935 small ribosomal subunit