Protein
MIA_05257_1
Length
216 amino acids
Browser: contig07:1146185-1146836+
Protein function
| EGGNOG: | 0PNCC | MED6 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery |
|---|---|---|---|
| SGD closest match: | S000001100 | MED6 | Mediator of RNA polymerase II transcription subunit 6 |
| CGD closest match: | CAL0000201522 | MED6 | Mediator of RNA polymerase II transcription subunit 6 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A1E3PR34_9ASCO | 67.742% | 155 | 1.10e-73 | MED6-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49741 PE=4 SV=1 |
| A0A0J9XHF8_GEOCN | 63.006% | 173 | 1.28e-72 | Similar to Saccharomyces cerevisiae YHR058C MED6 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA18s00824g PE=4 SV=1 |
| A0A060SZY4_BLAAD | 68.627% | 153 | 5.65e-73 | Mediator of RNA polymerase II transcription subunit 6 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C08206g PE=3 SV=1 |
| UniRef50_A0A060SZY4 | 68.627% | 153 | 1.39e-69 | Mediator of RNA polymerase II transcription subunit 6 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SZY4_BLAAD |
| A0A167DWC9_9ASCO | 64.331% | 157 | 7.67e-70 | Med6p OS=Sugiyamaella lignohabitans GN=MED6 PE=4 SV=1 |
| MCA_03661_1 | 54.124% | 194 | 1.74e-68 | MCA_03661_1 |
| MED6_YARLI | 59.494% | 158 | 1.48e-61 | Mediator of RNA polymerase II transcription subunit 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED6 PE=3 SV=1 |
| A0A1E4TD13_9ASCO | 56.061% | 132 | 3.46e-48 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_14293 PE=4 SV=1 |
| MED6_YEAST | 39.303% | 201 | 1.03e-41 | Mediator of RNA polymerase II transcription subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED6 PE=1 SV=1 |
| MED6_CANAL | 44.231% | 156 | 7.07e-42 | Mediator of RNA polymerase II transcription subunit 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED6 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0216
Protein family membership
- Mediator complex, subunit Med6 (IPR007018)
- Mediator complex, subunit Med6, fungi (IPR016612)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04934 (Med6)
-
-
-
PIRSF013286 (MED6_f...)
-
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_05257_1 MESTSPLDEVQWKHPEWIQRNGLRTDNVLEYFSLSPFYDRSSNNQVLKMQSQYNELNTRGNDLYKELQNMKGLEFVVAIA REPDLWVIRKQDRIGPLEVHPISTYFVVGENIYMAPAVHTIIQNRVLSIASSLTKALSIARTLPTFSPSQGYIYKNDPQL LSSSTNTPSESSADGENITPHTPAEERQAQFNINNALSHALSNHNVYLEDNLQKLD
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex