Protein

MIA_05257_1

Length
216 amino acids


Browser: contig07:1146185-1146836+

Protein function

EGGNOG:0PNCCMED6Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery
SGD closest match:S000001100MED6Mediator of RNA polymerase II transcription subunit 6
CGD closest match:CAL0000201522MED6Mediator of RNA polymerase II transcription subunit 6

Protein alignments

%idAln lengthE-value
A0A1E3PR34_9ASCO67.742%1551.10e-73MED6-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49741 PE=4 SV=1
A0A0J9XHF8_GEOCN63.006%1731.28e-72Similar to Saccharomyces cerevisiae YHR058C MED6 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA18s00824g PE=4 SV=1
A0A060SZY4_BLAAD68.627%1535.65e-73Mediator of RNA polymerase II transcription subunit 6 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C08206g PE=3 SV=1
UniRef50_A0A060SZY468.627%1531.39e-69Mediator of RNA polymerase II transcription subunit 6 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SZY4_BLAAD
A0A167DWC9_9ASCO64.331%1577.67e-70Med6p OS=Sugiyamaella lignohabitans GN=MED6 PE=4 SV=1
MCA_03661_154.124%1941.74e-68MCA_03661_1
MED6_YARLI59.494%1581.48e-61Mediator of RNA polymerase II transcription subunit 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED6 PE=3 SV=1
A0A1E4TD13_9ASCO56.061%1323.46e-48Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_14293 PE=4 SV=1
MED6_YEAST39.303%2011.03e-41Mediator of RNA polymerase II transcription subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED6 PE=1 SV=1
MED6_CANAL44.231%1567.07e-42Mediator of RNA polymerase II transcription subunit 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED6 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0216

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_05257_1
MESTSPLDEVQWKHPEWIQRNGLRTDNVLEYFSLSPFYDRSSNNQVLKMQSQYNELNTRGNDLYKELQNMKGLEFVVAIA
REPDLWVIRKQDRIGPLEVHPISTYFVVGENIYMAPAVHTIIQNRVLSIASSLTKALSIARTLPTFSPSQGYIYKNDPQL
LSSSTNTPSESSADGENITPHTPAEERQAQFNINNALSHALSNHNVYLEDNLQKLD

GO term prediction

Biological Process

GO:0006357 regulation of transcription from RNA polymerase II promoter

Molecular Function

GO:0001104 RNA polymerase II transcription cofactor activity

Cellular Component

GO:0016592 mediator complex