Protein
MCA_03661_1
Length
380 amino acids
Gene name: MED6
Description: Mediator of RNA polymerase II transcription subunit 6
Browser: contigC:714134-715277+
RNA-seq: read pairs 308, FPKM 10.0, percentile rank 25.9% (100% = highest expression)
Protein function
Annotation: | MED6 | Mediator of RNA polymerase II transcription subunit 6 | |
---|---|---|---|
KEGG: | K15128 | MED6 | mediator of RNA polymerase II transcription subunit 6 |
EGGNOG: | 0PNCC | MED6 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery |
SGD closest match: | S000001100 | MED6 | Mediator of RNA polymerase II transcription subunit 6 |
CGD closest match: | CAL0000201522 | MED6 | Mediator of RNA polymerase II transcription subunit 6 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05257_1 | 54.12% | 194 | 2e-67 | MIA_05257_1 |
A0A0J9XHF8_GEOCN | 51.30% | 193 | 1e-58 | Similar to Saccharomyces cerevisiae YHR058C MED6 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA18s00824g PE=4 SV=1 |
UniRef50_A0A0J9XHF8 | 51.30% | 193 | 2e-55 | Similar to Saccharomyces cerevisiae YHR058C MED6 Subunit of the RNA polymerase II mediator complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHF8_GEOCN |
A0A060SZY4_BLAAD | 49.22% | 193 | 5e-56 | Mediator of RNA polymerase II transcription subunit 6 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C08206g PE=3 SV=1 |
A0A167DWC9_9ASCO | 44.67% | 197 | 2e-51 | Med6p OS=Sugiyamaella lignohabitans GN=MED6 PE=4 SV=1 |
A0A1E3PR34_9ASCO | 44.56% | 193 | 3e-51 | MED6-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49741 PE=4 SV=1 |
MED6_YARLI | 43.52% | 193 | 2e-47 | Mediator of RNA polymerase II transcription subunit 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED6 PE=3 SV=1 |
MED6_CANAL | 39.90% | 193 | 8e-41 | Mediator of RNA polymerase II transcription subunit 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED6 PE=3 SV=1 |
A0A1E4TD13_9ASCO | 42.11% | 171 | 8e-37 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_14293 PE=4 SV=1 |
MED6_YEAST | 35.38% | 212 | 2e-32 | Mediator of RNA polymerase II transcription subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0126
Protein family membership
- Mediator complex, subunit Med6 (IPR007018)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_03661_1 MADQYTVSKDNDSKPEIQQQLEPLDELQWRAPEWIQLNGLRTDNVLEYFSLSPFYDRSANNQVLKMQTQYNVSPSPTNNN NNNNNNNNNNNNNAAAAAAAAAAMYNQYNGLGNGPINDMYAELRQMTGLEFVVAIARPPDFWVIRKQERVSPEHAEPIST YFVVGENVYMAPKIYDVLESRVLALGQNLAKAVSLAESLKTFVPSVGYVYKNEARLNYTNENDVKKSNNNKKKKKKLTTT TTEKKLDDNNTTTTDPSSQSNNNKDDNKNMMDIDKDEHDEKEEEEQEQEQDELEDKLTIAEKRQSFYNIDIALNLTLANK FAYLDDSIQEELDQQVLQHHFQQQSSSSQQDPNNSHPNQPLQHNPSQLNLAAMNQHIQRR
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex