Protein

MIA_05234_1

Length
166 amino acids

Browser: contig07:1094727-1095228+

Protein function

EGGNOG:0PGC7RPL1160s ribosomal protein l11
SGD closest match:S000003317RPL11B60S ribosomal protein L11-B
CGD closest match:CAL0000192242RPL11Ribosomal 60S subunit protein L11B

Protein alignments

%idAln lengthE-value
A0A0J9XJ22_GEOCN86.747%1662.15e-97Similar to Saccharomyces cerevisiae YGR085C RPL11B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA22s00417g PE=3 SV=1
MCA_04771_288.554%1662.87e-96MCA_04771_2
A0A1E4TIQ3_9ASCO81.928%1664.66e-94Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_73910 PE=3 SV=1
A0A060TDJ2_BLAAD84.049%1634.73e-93ARAD1D48202p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D48202g PE=3 SV=1
A0A167CVN2_9ASCO87.117%1639.61e-93Ribosomal 60S subunit protein L11B OS=Sugiyamaella lignohabitans GN=RPL11B PE=3 SV=1
Q6CEJ8_YARLI84.049%1631.06e-92YALI0B15103p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B15103g PE=3 SV=2
A0A1D8PHW1_CANAL84.337%1666.59e-90Ribosomal 60S subunit protein L11B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL11 PE=3 SV=1
A0A1E3PMX3_9ASCO84.049%1634.67e-9060S ribosomal protein L11-A (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22507 PE=3 SV=1
RL11B_YEAST81.325%1664.30e-8860S ribosomal protein L11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11B PE=1 SV=3
UniRef50_P0C0W981.325%1661.06e-8460S ribosomal protein L11-A n=569 Tax=Eukaryota TaxID=2759 RepID=RL11A_YEAST

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1141

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 166

Detailed signature matches

  1. Family IPR002132
    Ribosomal protein L5
    1. PIRSF002161 (RPL5p_...)
  2. Domain IPR031310
    Ribosomal protein L5, N-terminal
    1. PF00281 (Ribosomal_L5)
  3. Domain IPR022803
    Ribosomal protein L5 domain
    1. G3DSA:3.30.14...
    2. SSF55282 (RL5-like)
  4. Domain IPR031309
    Ribosomal protein L5, C-terminal
    1. PF00673 (Ribosomal_...)
  5. SITE IPR020929
    Ribosomal protein L5, conserved site
    1. PS00358 (RIBOSOMAL_L5)

Protein sequence

>MIA_05234_1
MRELRIEKLTLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRNEKIAVHVTIRGPKAEEILERGLKVKE
YELKERNFSDSGNFGFGVTEHIDLGIKYDPNIGIYGMDFYVVMGRKGARVARRKRARGTIGLGHKITKEDSIKWFKQKYD
AIVSNK

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome