Protein

MCA_04771_2

Length
174 amino acids


Gene name: RPL11

Description: Ribosomal 60S subunit protein L11B

Browser: contigC:3991236-3992180-

RNA-seq: read pairs 62312, FPKM 4399.6, percentile rank 99.4% (100% = highest expression)

Protein function

Annotation:RPL11Ribosomal 60S subunit protein L11B
KEGG:K02868RP-L11e large subunit ribosomal protein L11e
EGGNOG:0PGC7RPL1160s ribosomal protein l11
SGD closest match:S000003317RPL11B60S ribosomal protein L11-B
CGD closest match:CAL0000192242RPL11Ribosomal 60S subunit protein L11B

Protein alignments

%idAln lengthE-value
A0A0J9XJ22_GEOCN88.51%1742e-115Similar to Saccharomyces cerevisiae YGR085C RPL11B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA22s00417g PE=3 SV=1
A0A1E4TIQ3_9ASCO84.30%1721e-109Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_73910 PE=3 SV=1
Q6CEJ8_YARLI83.04%1711e-107YALI0B15103p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B15103g PE=3 SV=2
A0A060TDJ2_BLAAD84.62%1695e-107ARAD1D48202p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D48202g PE=3 SV=1
A0A1D8PHW1_CANAL82.76%1741e-105Ribosomal 60S subunit protein L11B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL11 PE=3 SV=1
RL11B_YEAST81.03%1742e-10460S ribosomal protein L11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11B PE=1 SV=3
UniRef50_P0C0W981.03%1746e-10160S ribosomal protein L11-A n=569 Tax=Eukaryota TaxID=2759 RepID=RL11A_YEAST
A0A167CVN2_9ASCO86.50%1632e-103Ribosomal 60S subunit protein L11B OS=Sugiyamaella lignohabitans GN=RPL11B PE=3 SV=1
A0A1E3PMX3_9ASCO81.18%1702e-10160S ribosomal protein L11-A (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22507 PE=3 SV=1
MIA_05234_188.55%1665e-101MIA_05234_1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3216

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 160 174

Detailed signature matches

    1. PIRSF002161 (RPL5p_...)
    1. SSF55282 (RL5-like)
    1. PF00281 (Ribosomal_L5)
    1. PF00673 (Ribosomal_...)
    1. PS00358 (RIBOSOMAL_L5)

Protein sequence

>MCA_04771_2
MSDKSSNPMRELRIEKLTLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRNEKIAVHVTVRGTKAEEII
ERGLKVKEYELKERNFSETGNFGFGVDEHIDLGIKYDPSIGIYGMDFYVVMGRKGNRVARRKRCKSVVGKSHQISREDTI
KWFKQKYDAIVSNK

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome