Protein
MIA_05232_1
Length
285 amino acids
Browser: contig07:1090587-1091573-
Protein function
| EGGNOG: | 0PFGV | FG06886.1 | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) |
|---|---|---|---|
| SGD closest match: | S000006307 | PRE2 | Proteasome subunit beta type-5 |
| CGD closest match: | CAL0000200516 | PRE2 | Proteasome core particle subunit beta 5 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04773_1 | 88.07% | 285 | 0.0 | MCA_04773_1 |
| A0A0J9XEC7_GEOCN | 84.45% | 283 | 0.0 | Similar to Saccharomyces cerevisiae YPR103W PRE2 Beta 5 subunit of the 20S proteasome OS=Geotrichum candidum GN=BN980_GECA12s00626g PE=4 SV=1 |
| A0A060TD53_BLAAD | 79.15% | 283 | 3e-170 | ARAD1D48246p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D48246g PE=4 SV=1 |
| PSB5_YEAST | 76.31% | 287 | 1e-163 | Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE2 PE=1 SV=3 |
| UniRef50_P30656 | 76.31% | 287 | 2e-160 | Proteasome subunit beta type-5 n=612 Tax=Eukaryota TaxID=2759 RepID=PSB5_YEAST |
| Q6CEJ2_YARLI | 75.79% | 285 | 3e-163 | YALI0B15224p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B15224g PE=4 SV=1 |
| A0A1E3PDZ6_9ASCO | 75.17% | 286 | 3e-161 | N-terminal nucleophile aminohydrolase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84580 PE=4 SV=1 |
| Q59Z65_CANAL | 75.62% | 283 | 2e-159 | Proteasome core particle subunit beta 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE2 PE=4 SV=1 |
| A0A1E4TIK0_9ASCO | 80.72% | 249 | 2e-154 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_124 PE=4 SV=1 |
| A0A167CVR0_9ASCO | 84.30% | 172 | 9e-108 | Proteasome core particle subunit beta 5 OS=Sugiyamaella lignohabitans GN=PRE2 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2794
Protein family membership
- Proteasome, subunit alpha/beta (IPR001353)
- Proteasome B-type subunit (IPR023333)
- Peptidase T1A, proteasome beta-subunit (IPR000243)
- Proteasome B-type subunit (IPR023333)
Domains and repeats
-
Domain
1
50
100
150
200
250
285
Detailed signature matches
no IPR
Unintegrated signatures
-
cd03761 (proteasome...)
Residue annotation
-
active site cd03761
-
beta subunit inter...
Protein sequence
>MIA_05232_1 MDAIAQKYSYEATLDRSAFEESEQDILDCELRTGIPEISLPPISRPTAFLRAHTDDNANPDVKIKIAHGTTTLAFRFQGG IVVAVDSRATAGNWISSQTVKKVIEINPFLLGTMAGGAADCQFWETWLGMQCRLHELREKHRISVAAASKILSNLTYEYK GMGLSMGTMICGYTKREGPAIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDASYKWDLTVEEALALGKRSILAATHRDAYS GGSVNLYHVTENGWIYHGNYDVNTEFWKAKEAEGSFNNVVMSLPN
GO term prediction
Biological Process
GO:0051603 proteolysis involved in cellular protein catabolic process
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
Cellular Component
GO:0005839 proteasome core complex