Protein

MIA_05232_1

Length
285 amino acids


Browser: contig07:1090587-1091573-

Protein function

EGGNOG:0PFGVFG06886.1The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000006307PRE2Proteasome subunit beta type-5
CGD closest match:CAL0000200516PRE2Proteasome core particle subunit beta 5

Protein alignments

%idAln lengthE-value
MCA_04773_188.07%2850.0MCA_04773_1
A0A0J9XEC7_GEOCN84.45%2830.0Similar to Saccharomyces cerevisiae YPR103W PRE2 Beta 5 subunit of the 20S proteasome OS=Geotrichum candidum GN=BN980_GECA12s00626g PE=4 SV=1
A0A060TD53_BLAAD79.15%2833e-170ARAD1D48246p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D48246g PE=4 SV=1
PSB5_YEAST76.31%2871e-163Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE2 PE=1 SV=3
UniRef50_P3065676.31%2872e-160Proteasome subunit beta type-5 n=612 Tax=Eukaryota TaxID=2759 RepID=PSB5_YEAST
Q6CEJ2_YARLI75.79%2853e-163YALI0B15224p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B15224g PE=4 SV=1
A0A1E3PDZ6_9ASCO75.17%2863e-161N-terminal nucleophile aminohydrolase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84580 PE=4 SV=1
Q59Z65_CANAL75.62%2832e-159Proteasome core particle subunit beta 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE2 PE=4 SV=1
A0A1E4TIK0_9ASCO80.72%2492e-154Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_124 PE=4 SV=1
A0A167CVR0_9ASCO84.30%1729e-108Proteasome core particle subunit beta 5 OS=Sugiyamaella lignohabitans GN=PRE2 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2794

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 285

Detailed signature matches

    1. PF00227 (Proteasome)
    1. PS51476 (PROTEASOME...)
    1. PR00141 (PROTEASOME)
    1. SSF56235 (N-termina...)
    1. PS00854 (PROTEASOME...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd03761 (proteasome...)

Residue annotation

  1. active site cd03761
  2. beta subunit inter...

Protein sequence

>MIA_05232_1
MDAIAQKYSYEATLDRSAFEESEQDILDCELRTGIPEISLPPISRPTAFLRAHTDDNANPDVKIKIAHGTTTLAFRFQGG
IVVAVDSRATAGNWISSQTVKKVIEINPFLLGTMAGGAADCQFWETWLGMQCRLHELREKHRISVAAASKILSNLTYEYK
GMGLSMGTMICGYTKREGPAIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDASYKWDLTVEEALALGKRSILAATHRDAYS
GGSVNLYHVTENGWIYHGNYDVNTEFWKAKEAEGSFNNVVMSLPN

GO term prediction

Biological Process

GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex