Protein

MIA_05230_1

Length
72 amino acids

Browser: contig07:1080649-1080913-

Protein function

SGD closest match:S000001180YHR138CUncharacterized protein YHR138C
CGD closest match:CAL0000188954orf19.2769Uncharacterized protein

Protein alignments

%idAln lengthE-value
MCA_04753_156.944%725.83e-24MCA_04753_1
A0A0J9XDS5_GEOCN47.143%705.71e-20Similar to Saccharomyces cerevisiae YNL015W PBI2 Cytosolic inhibitor of vacuolar proteinase B (PRB1),required for efficient vacuole inheritance OS=Geotrichum candidum GN=BN980_GECA12s00659g PE=4 SV=1
A0A1E3PI62_9ASCO48.571%701.15e-19Protease propeptide/inhibitor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52263 PE=4 SV=1
UniRef50_A0A1E3PI6248.571%703.12e-16Protease propeptide/inhibitor n=7 Tax=saccharomyceta TaxID=716545 RepID=A0A1E3PI62_9ASCO
B5RSJ5_YARLI46.667%759.47e-17YALI0A01452p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A01452g PE=4 SV=1
A0A060TDJ9_BLAAD49.275%698.26e-16ARAD1D48334p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D48334g PE=4 SV=1
Q5AF37_CANAL40.580%692.36e-10Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2769 PE=4 SV=1
YHT8_YEAST47.059%511.60e-06Uncharacterized protein YHR138C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR138C PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2134

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 10 20 30 40 50 60 72

Detailed signature matches

  1. Domain IPR010259
    Peptidase S8 propeptide/proteinase inhibitor I9
    1. PF05922 (Inhibitor_I9)
    2. G3DSA:3.30.70.80
  2. Domain IPR009020
    Protease propeptides/proteinase inhibitor I9
    1. SSF54897 (Protease ...)

Protein sequence

>MIA_05230_1
MPSSYIVRFKDDTPEEVKSQIKSDLVAAGGKISQEYSLIQGFACTLPDEYVSTLSSHPHIAGFEQDQVVTTQ

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.