Protein

MCA_04753_1

Length
72 amino acids


Browser: contigC:3944328-3944841-

RNA-seq: read pairs 2961, FPKM 501.2, percentile rank 94.2% (100% = highest expression)

Protein function

EGGNOG:0PTAXPeptidase inhibitor I9
SGD closest match:S000004960PBI2Protease B inhibitor 2
CGD closest match:CAL0000188954orf19.2769Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_05230_156.94%727e-23MIA_05230_1
UniRef50_U4LV4853.73%673e-14Similar to Protease B inhibitors 2 and 1 acc. no. P01095 n=1 Tax=Pyronema omphalodes (strain CBS 100304) TaxID=1076935 RepID=U4LV48_PYROM
A0A1E3PI62_9ASCO46.38%691e-17Protease propeptide/inhibitor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52263 PE=4 SV=1
Q6C241_YARLI45.83%724e-16YALI0F11077p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F11077g PE=4 SV=1
A0A0J9XDS5_GEOCN44.78%672e-15Similar to Saccharomyces cerevisiae YNL015W PBI2 Cytosolic inhibitor of vacuolar proteinase B (PRB1),required for efficient vacuole inheritance OS=Geotrichum candidum GN=BN980_GECA12s00659g PE=4 SV=1
A0A060TDJ9_BLAAD42.03%692e-15ARAD1D48334p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D48334g PE=4 SV=1
Q5AF37_CANAL43.66%717e-12Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2769 PE=4 SV=1
IPB2_YEAST42.47%735e-07Protease B inhibitor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBI2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1168

Protein family membership

None predicted.

Domains and repeats

1 10 20 30 40 50 60 72

Detailed signature matches

    1. PF05922 (Inhibitor_I9)
    1. SSF54897 (Protease ...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_04753_1
MPKNVIVTFKDGTSADVISKAKSDLESSGGKITNEYSLIPGFSAEVPDDNVSTLSSHPDVASVEEDQEVKIQ

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.