Protein

MIA_05213_1

Length
95 amino acids

Browser: contig07:1040695-1041049-

Protein function

EGGNOG:0PT1HInherit from NOG: NADH-ubiquinone oxidoreductase 12 kda subunit
CGD closest match:CAL0000191739CAALFM_CR01300WAUncharacterized protein

Protein alignments

%idAln lengthE-value
A0A0J9X955_GEOCN87.097%932.57e-58NIDM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA05s00164g PE=4 SV=1
MCA_04904_177.895%952.02e-54MCA_04904_1
A0A060T4C2_BLAAD79.570%932.35e-53ARAD1A15818p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A15818g PE=4 SV=1
B5RSK3_YARLI67.033%917.56e-47YALI0A17946p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A17946g PE=4 SV=1
UniRef50_A0A1D2VPV964.045%899.20e-37Uncharacterized protein n=1 Tax=Ascoidea rubescens DSM 1968 TaxID=1344418 RepID=A0A1D2VPV9_9ASCO
A0A1E4TBL7_9ASCO51.087%927.23e-32Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_53660 PE=4 SV=1
A0A1D8PRX9_CANAL48.276%875.71e-27Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR01300WA PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0315

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR019377
    NADH-ubiquinone oxidoreductase, subunit 10
    1. PF10249 (NDUFB10)
  2. Family IPR020163
    Complex I subunit NDUFS6
    1. PD069254

Protein sequence

>MIA_05213_1
MARSTEHQRPELVSFDDIDYSDNLALKQAQDSFVREQWIRVEALKTVRRALEKCFQTQGVNQYENCKDIAERYLDMLPTH
RVKGYLAYQRNDPRK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.