Protein
MCA_04904_1
Length
95 amino acids
Browser: contigC:4382152-4382751+
RNA-seq: read pairs 5578, FPKM 717.9, percentile rank 95.6% (100% = highest expression)
Protein function
| EGGNOG: | 0PT1H | Inherit from NOG: NADH-ubiquinone oxidoreductase 12 kda subunit | |
|---|---|---|---|
| CGD closest match: | CAL0000191739 | CAALFM_CR01300WA | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05213_1 | 77.89% | 95 | 5e-53 | MIA_05213_1 |
| A0A0J9X955_GEOCN | 78.49% | 93 | 2e-52 | NIDM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA05s00164g PE=4 SV=1 |
| A0A060T4C2_BLAAD | 77.42% | 93 | 5e-52 | ARAD1A15818p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A15818g PE=4 SV=1 |
| B5RSK3_YARLI | 61.54% | 91 | 4e-41 | YALI0A17946p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A17946g PE=4 SV=1 |
| UniRef50_E1UWC9 | 58.24% | 91 | 2e-35 | NIDM (PDSW) subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I) n=17 Tax=Saccharomycetales TaxID=4892 RepID=E1UWC9_PICPA |
| A0A1E4TBL7_9ASCO | 48.91% | 92 | 2e-28 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_53660 PE=4 SV=1 |
| A0A1D8PRX9_CANAL | 44.94% | 89 | 2e-26 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR01300WA PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0276
Protein family membership
- Complex I subunit NDUFS6 (IPR020163)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_04904_1 MTRSTEHKRPELVSFDDIDYSDPKALQAAQNSMIREQWIQVAEVTTVRKALEKCFQTQGPNQYENCKEIAELYLDMLPSH RVKGFLAYQRNDPTK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.