Protein

MIA_05152_1

Length
152 amino acids


Browser: contig07:858943-859402+

Protein function

EGGNOG:0PPQRNCB2transcription corepressor activity
SGD closest match:S000002805NCB2Negative cofactor 2 complex subunit beta
CGD closest match:CAL0000180502NCB2Negative cofactor 2 transcription regulator complex subunit

Protein alignments

%idAln lengthE-value
MCA_05816_180.620%1295.91e-74MCA_05816_1
A0A0J9XD69_GEOCN79.845%1291.56e-72Similar to Saccharomyces cerevisiae YDR397C NCB2 Subunit of a heterodimeric NC2 transcription regulator complex with Bur6p OS=Geotrichum candidum GN=BN980_GECA08s04707g PE=4 SV=1
Q6C5P7_YARLI74.419%1291.75e-67YALI0E16294p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E16294g PE=4 SV=2
A0A060T397_BLAAD84.685%1117.07e-67ARAD1A14036p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A14036g PE=4 SV=1
A0A167DGW0_9ASCO82.759%1164.77e-66Ncb2p OS=Sugiyamaella lignohabitans GN=NCB2 PE=4 SV=1
A0A1E3PDS8_9ASCO75.969%1291.60e-61Histone-fold-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_28335 PE=4 SV=1
A0A1E4THG2_9ASCO61.983%1212.95e-51Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2916 PE=4 SV=1
UniRef50_K2STT358.015%1312.27e-45Transcription factor CBF/NF-Y/archaeal histone n=1 Tax=Macrophomina phaseolina (strain MS6) TaxID=1126212 RepID=K2STT3_MACPH
Q5A0I6_CANAL53.509%1141.93e-39Negative cofactor 2 transcription regulator complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCB2 PE=4 SV=1
NCB2_YEAST46.296%1084.99e-30Negative cofactor 2 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCB2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0226

Protein family membership

None predicted.

Domains and repeats

1 20 40 60 80 100 120 140 152

Detailed signature matches

    1. SSF47113 (Histone-fold)
    1. PF00808 (CBFD_NFYB_HMF)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_05152_1
MSDRGDHGGDDLSLPKATVQKIVSEIIPPDLVFSRETRDALIECCIEFIMILTTESNDIAEKESKKTIACEHVLKALETL
GFYDYIEPIKGVIAQHKEAQKVRERKVGKLEQSGRSEEDLMREQERLFGQARSKLQNSQQQQQHQDPPSSSS

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0046982 protein heterodimerization activity

Cellular Component

None predicted.