Protein

MCA_05816_1

Length
211 amino acids

Gene name: NCB2

Description: Negative cofactor 2 complex subunit beta

Browser: contigD:2413360-2413996-

RNA-seq: read pairs 1639, FPKM 95.5, percentile rank 77.9% (100% = highest expression)

Protein function

Annotation:NCB2Negative cofactor 2 complex subunit beta
KEGG:K21751DR1 down-regulator of transcription 1
EGGNOG:0PPQRNCB2transcription corepressor activity
SGD closest match:S000002805NCB2Negative cofactor 2 complex subunit beta
CGD closest match:CAL0000180502NCB2Negative cofactor 2 transcription regulator complex subunit

Protein alignments

%idAln lengthE-value
MIA_05152_180.74%1353e-76MIA_05152_1
A0A0J9XD69_GEOCN69.12%1364e-67Similar to Saccharomyces cerevisiae YDR397C NCB2 Subunit of a heterodimeric NC2 transcription regulator complex with Bur6p OS=Geotrichum candidum GN=BN980_GECA08s04707g PE=4 SV=1
Q6C5P7_YARLI70.07%1371e-65YALI0E16294p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E16294g PE=4 SV=2
A0A060T397_BLAAD68.12%1388e-61ARAD1A14036p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A14036g PE=4 SV=1
A0A167DGW0_9ASCO69.85%1361e-59Ncb2p OS=Sugiyamaella lignohabitans GN=NCB2 PE=4 SV=1
A0A1E3PDS8_9ASCO69.85%1362e-58Histone-fold-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_28335 PE=4 SV=1
A0A1E4THG2_9ASCO63.91%1336e-55Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2916 PE=4 SV=1
UniRef50_A0A0H5BXX861.03%1362e-46Negative cofactor 2 complex subunit beta Short=NC2 complex subunit beta n=82 Tax=saccharomyceta TaxID=716545 RepID=A0A0H5BXX8_CYBJA
Q5A0I6_CANAL52.34%1281e-36Negative cofactor 2 transcription regulator complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCB2 PE=4 SV=1
NCB2_YEAST47.29%1294e-31Negative cofactor 2 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCB2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0291

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 200 211

Detailed signature matches

  1. Domain IPR009072
    Histone-fold
    1. SSF47113 (Histone-fold)
  2. Domain IPR003958
    Transcription factor CBF/NF-Y/archaeal histone domain
    1. PF00808 (CBFD_NFYB_HMF)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.20.10
  2. mobidb-lite (disord...)

Protein sequence

>MCA_05816_1
MSDREHMNDDLSLPKATVQKIIAEVIPSDLSFGKDTRDALIECCIEFIMIVTTESNEIAEQESKKTIACEHVLSALKTLG
FYEYLAPIKEVIAQHREAQKIRERKVGKLEQSGRSEEDLQREQEMLFGQARSRLQNIQKPGSGGSQSTTSSAPPSASSNT
TENGASSAVKTEELEVKKEESTSVKQEENVSQQNTTTDSKQNDSDYLGGWR

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0046982 protein heterodimerization activity

Cellular Component

None predicted.