Protein

MIA_05143_1

Length
394 amino acids

Browser: contig07:838527-839767-

Protein function

EGGNOG:0PGQGPAN5Catalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid (By similarity)
SGD closest match:S000001105PAN52-dehydropantoate 2-reductase
CGD closest match:CAL0000174456orf19.40062-dehydropantoate 2-reductase

Protein alignments

%idAln lengthE-value
MCA_00259_148.058%4121.14e-126MCA_00259_1
A0A0J9XIN9_GEOCN43.032%4096.55e-99Similar to Saccharomyces cerevisiae YHR063C PAN5 2-dehydropantoate 2-reductase OS=Geotrichum candidum GN=BN980_GECA17s00615g PE=4 SV=1
UniRef50_A0A0J9XIN943.032%4091.34e-95Similar to Saccharomyces cerevisiae YHR063C PAN5 2-dehydropantoate 2-reductase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIN9_GEOCN
A0A1D8PP61_CANAL32.987%3853.02e-502-dehydropantoate 2-reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4006 PE=4 SV=1
A0A1E4TH77_9ASCO34.174%3572.53e-47Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_148169 PE=4 SV=1
A0A1E3PNI2_9ASCO31.500%4003.90e-462-dehydropantoate 2-reductase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45225 PE=4 SV=1
Q6C0X8_YARLI28.173%3941.20e-40YALI0F20900p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F20900g PE=4 SV=1
PANE_YEAST29.491%3739.89e-392-dehydropantoate 2-reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN5 PE=1 SV=1
A0A167CG35_9ASCO37.313%2019.25e-312-dehydropantoate 2-reductase PAN5 OS=Sugiyamaella lignohabitans GN=PAN5 PE=4 SV=1
A0A060T6E4_BLAAD33.010%2061.93e-26ARAD1B11396p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B11396g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4490

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 394

Detailed signature matches

  1. Family IPR003710
    Ketopantoate reductase ApbA/PanE
    1. TIGR00745
  2. Domain IPR016040
    NAD(P)-binding domain
    1. SSF51735 (NAD(P)-bi...)
  3. Domain IPR013332
    Ketopantoate reductase, N-terminal domain
    1. PF02558 (ApbA)
  4. Domain IPR013328
    6-phosphogluconate dehydrogenase, domain 2
    1. G3DSA:1.10.10...
  5. Domain IPR008927
    6-phosphogluconate dehydrogenase C-terminal domain-like
    1. SSF48179 (6-phospho...)
  6. Domain IPR013752
    Ketopantoate reductase, C-terminal domain
    1. PF08546 (ApbA_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...

Protein sequence

>MIA_05143_1
MAGPRIHILGAGNIGSLVATSLAATPGKTYQPFVNLILRSPERVREYERQGGALTIHRTVAGVPVEISRQIPAIDPNSLV
RRYQYSLDSTDNNRRRNTDKSSLDNLIVSVKTHQTVSALGPLVPAITTSTSILLLQNGMGSYESLCRTYWPDPALRPQFY
VAITTHGVNSIGTPHDKHLANFSFNHASPGYITIARVPSNLQLAETSDEALEKKNEEDAGRRSPLVQALERAPGLKARYV
PYPEFLVSQVDKLVANAVINPLTALYECYNGELTALSGLDRIVYGLSRECVEVFCAEYADVIPAADLHASFNVARFADIV
SNVIKATAENRSSMLQDVLALRDTEIDEICGYVVRLGNKHGKGVFHHRMMLDLIKSKVSLGRDREKRRVPIVNI

GO term prediction

Biological Process

GO:0015940 pantothenate biosynthetic process
GO:0055114 oxidation-reduction process

Molecular Function

GO:0008677 2-dehydropantoate 2-reductase activity
GO:0016491 oxidoreductase activity
GO:0050661 NADP binding

Cellular Component

GO:0005737 cytoplasm