Protein

MIA_05141_1

Length
262 amino acids


Browser: contig07:835702-836491-

Protein function

EGGNOG:0PPYWFG08693.1Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate (By similarity)
SGD closest match:S000004229LIP2Octanoyltransferase, mitochondrial
CGD closest match:CAL0000185298orf19.3010Octanoyltransferase

Protein alignments

%idAln lengthE-value
A0A0J9YHE7_GEOCN56.705%2612.28e-93Octanoyltransferase OS=Geotrichum candidum GN=BN980_GECA01s03189g PE=3 SV=1
UniRef50_A0A0J9YHE756.705%2614.66e-90Octanoyltransferase n=3 Tax=saccharomyceta TaxID=716545 RepID=A0A0J9YHE7_GEOCN
A0A060TBU4_BLAAD49.807%2592.41e-75Octanoyltransferase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B11352g PE=3 SV=1
MCA_00265_141.837%2941.84e-67MCA_00265_1
A0A1E3PQ83_9ASCO47.788%2263.23e-63Lipoyltransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81627 PE=4 SV=1
A0A1E4TH78_9ASCO51.381%1812.85e-54Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_11983 PE=4 SV=1
Q6C069_YARLI40.840%2622.94e-52Octanoyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F27357g PE=3 SV=1
LIPB_YEAST36.735%2459.04e-43Octanoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LIP2 PE=1 SV=1
Q5AI42_CANAL34.419%2151.33e-25Octanoyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3010 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9911
Predicted cleavage: 30

Protein family membership

Domains and repeats

Detailed signature matches

    1. cd16444 (LipB)
    2. PIRSF016262 (LPLase)
    1. PF03099 (BPL_LplA_LipB)
    2. PS51733 (BPL_LPL_CA...)
    1. PS01313 (LIPB)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF55681 (Class II ...)

Residue annotation

  1. active site cd16444
  2. catalytic site cd1...

Protein sequence

>MIA_05141_1
MSCSLKVWPKPGTPSRLVHRCFAGSVLPYYRGTEIMDQTVRQFLDSKLRSAPAGSPAPVSTLLTFQFQPTYTLGRRERDS
FNKDASLVNHLSDGGAAAVVPTFRGGQTTFHGPGQLVAYPILDLRAFSSTTDAAGLPVRCYVELLERTIISTLRRRYGLS
AMTTENTGVWVDPDHKICALGIHVRRHITSHGIALNVSTDTHRWFDRIVACGLPDKQTTSIAQQLSAGGETGVDLSVTSA
AHAFAQELAESFGLELEEEYIE

GO term prediction

Biological Process

GO:0006464 cellular protein modification process
GO:0009107 lipoate biosynthetic process

Molecular Function

GO:0016415 octanoyltransferase activity
GO:0033819 lipoyl(octanoyl) transferase activity

Cellular Component

GO:0005737 cytoplasm