Protein

MIA_05141_1

Length
262 amino acids

Browser: contig07:835702-836491-

Protein function

EGGNOG:0PPYWFG08693.1Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate (By similarity)
SGD closest match:S000004229LIP2Octanoyltransferase, mitochondrial
CGD closest match:CAL0000185298orf19.3010Octanoyltransferase

Protein alignments

%idAln lengthE-value
A0A0J9YHE7_GEOCN56.705%2612.28e-93Octanoyltransferase OS=Geotrichum candidum GN=BN980_GECA01s03189g PE=3 SV=1
UniRef50_A0A0J9YHE756.705%2614.66e-90Octanoyltransferase n=3 Tax=saccharomyceta TaxID=716545 RepID=A0A0J9YHE7_GEOCN
A0A060TBU4_BLAAD49.807%2592.41e-75Octanoyltransferase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B11352g PE=3 SV=1
MCA_00265_141.837%2941.84e-67MCA_00265_1
A0A1E3PQ83_9ASCO47.788%2263.23e-63Lipoyltransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81627 PE=4 SV=1
A0A1E4TH78_9ASCO51.381%1812.85e-54Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_11983 PE=4 SV=1
Q6C069_YARLI40.840%2622.94e-52Octanoyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F27357g PE=3 SV=1
LIPB_YEAST36.735%2459.04e-43Octanoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LIP2 PE=1 SV=1
Q5AI42_CANAL34.419%2151.33e-25Octanoyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3010 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9911
Predicted cleavage: 30

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 262

Detailed signature matches

  1. Family IPR000544
    Octanoyltransferase
    1. TIGR00214
    2. cd16444 (LipB)
    3. PIRSF016262 (LPLase)
  2. Domain IPR004143
    Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL), catalytic domain
    1. PF03099 (BPL_LplA_LipB)
    2. PS51733 (BPL_LPL_CA...)
  3. SITE IPR020605
    Octanoyltransferase, conserved site
    1. PS01313 (LIPB)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.93...
  2. PD006086
  3. SSF55681 (Class II ...)

Residue annotation

  1. active site cd16444
  2. catalytic site cd1...

Protein sequence

>MIA_05141_1
MSCSLKVWPKPGTPSRLVHRCFAGSVLPYYRGTEIMDQTVRQFLDSKLRSAPAGSPAPVSTLLTFQFQPTYTLGRRERDS
FNKDASLVNHLSDGGAAAVVPTFRGGQTTFHGPGQLVAYPILDLRAFSSTTDAAGLPVRCYVELLERTIISTLRRRYGLS
AMTTENTGVWVDPDHKICALGIHVRRHITSHGIALNVSTDTHRWFDRIVACGLPDKQTTSIAQQLSAGGETGVDLSVTSA
AHAFAQELAESFGLELEEEYIE

GO term prediction

Biological Process

GO:0006464 cellular protein modification process
GO:0009107 lipoate biosynthetic process

Molecular Function

GO:0016415 octanoyltransferase activity
GO:0033819 lipoyl(octanoyl) transferase activity

Cellular Component

GO:0005737 cytoplasm