Protein
MIA_05134_1
Length
123 amino acids
Browser: contig07:827843-828260+
Protein function
EGGNOG: | 0PQZP | FG10963.1 | tubulin complex assembly |
---|---|---|---|
SGD closest match: | S000004190 | YKE2 | Prefoldin subunit 6 |
CGD closest match: | CAL0000187726 | YKE2 | Tubulin-binding prefolding complex subunit |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A060T5G8_BLAAD | 52.525% | 99 | 5.27e-31 | ARAD1B11198p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B11198g PE=4 SV=1 |
UniRef50_W1QFT8 | 51.020% | 98 | 2.58e-27 | Prefoldin subunit 6 n=15 Tax=Saccharomycetales TaxID=4892 RepID=W1QFT8_OGAPD |
A0A1E3PHI0_9ASCO | 47.863% | 117 | 1.42e-28 | Prefoldin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46718 PE=4 SV=1 |
A0A0J9XIP2_GEOCN | 55.769% | 104 | 1.22e-27 | Similar to Saccharomyces cerevisiae YLR200W YKE2 Subunit of the heterohexameric Gim/prefoldin protein complex involved in the folding of alpha-tubulin OS=Geotrichum candidum GN=BN980_GECA17s00703g PE=4 SV=1 |
PFD6_YEAST | 50.000% | 104 | 6.94e-27 | Prefoldin subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKE2 PE=1 SV=1 |
Q6C8T7_YARLI | 46.535% | 101 | 1.81e-26 | YALI0D17086p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D17086g PE=4 SV=2 |
MCA_00268_1 | 44.915% | 118 | 6.24e-25 | MCA_00268_1 |
A0A1E4TES4_9ASCO | 34.286% | 105 | 5.25e-17 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31285 PE=4 SV=1 |
A0A1D8PU06_CANAL | 35.965% | 114 | 1.73e-14 | Tubulin-binding prefolding complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YKE2 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1057
Protein family membership
- Prefoldin beta-like (IPR002777)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01920 (Prefoldin_2)
-
no IPR
Unintegrated signatures
Residue annotation
-
Prefoldin subunit ...
Protein sequence
>MIA_05134_1 MSAPSSTTPPEVNELIDHLSALQAELGDLIRSRETLEVQLKENTIVKDEFDTLGDDAKVYKLTGPVLLPQSKGEAETNVN TRLDFIKKEIERVEKNIAAKQESIMENRNKLAAMSAPPQPQAA
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex