MIA_05134_1

Protein

Length

123 amino acids

EGGNOG:	0PQZP	FG10963.1	tubulin complex assembly
SGD closest match:	S000004190	YKE2	Prefoldin subunit 6
CGD closest match:	CAL0000187726	YKE2	Tubulin-binding prefolding complex subunit

	%id	Aln length	E-value
A0A060T5G8_BLAAD	52.525%	99	5.27e-31	ARAD1B11198p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B11198g PE=4 SV=1
UniRef50_W1QFT8	51.020%	98	2.58e-27	Prefoldin subunit 6 n=15 Tax=Saccharomycetales TaxID=4892 RepID=W1QFT8_OGAPD
A0A1E3PHI0_9ASCO	47.863%	117	1.42e-28	Prefoldin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46718 PE=4 SV=1
A0A0J9XIP2_GEOCN	55.769%	104	1.22e-27	Similar to Saccharomyces cerevisiae YLR200W YKE2 Subunit of the heterohexameric Gim/prefoldin protein complex involved in the folding of alpha-tubulin OS=Geotrichum candidum GN=BN980_GECA17s00703g PE=4 SV=1
PFD6_YEAST	50.000%	104	6.94e-27	Prefoldin subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKE2 PE=1 SV=1
Q6C8T7_YARLI	46.535%	101	1.81e-26	YALI0D17086p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D17086g PE=4 SV=2
MCA_00268_1	44.915%	118	6.24e-25	MCA_00268_1
A0A1E4TES4_9ASCO	34.286%	105	5.25e-17	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31285 PE=4 SV=1
A0A1D8PU06_CANAL	35.965%	114	1.73e-14	Tubulin-binding prefolding complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YKE2 PE=4 SV=1

Probability of mitochondrial location: 0.1057

None predicted.

no IPR

Unintegrated signatures

>MIA_05134_1
MSAPSSTTPPEVNELIDHLSALQAELGDLIRSRETLEVQLKENTIVKDEFDTLGDDAKVYKLTGPVLLPQSKGEAETNVN
TRLDFIKKEIERVEKNIAAKQESIMENRNKLAAMSAPPQPQAA

GO:0006457 protein folding

GO:0051082 unfolded protein binding

GO:0016272 prefoldin complex

Filter view on