Protein
MCA_00268_1
Length
143 amino acids
Gene name: YKE2
Description: Prefoldin subunit 6; in S. cerevisiae a subunit of the heterohexameric Gim/prefoldin protein complex
Browser: contigA:813140-813662-
RNA-seq: read pairs 607, FPKM 52.1, percentile rank 66.3% (100% = highest expression)
Protein function
| Annotation: | YKE2 | Prefoldin subunit 6; in S. cerevisiae a subunit of the heterohexameric Gim/prefoldin protein complex | |
|---|---|---|---|
| KEGG: | K04798 | pfdB | prefoldin beta subunit |
| EGGNOG: | 0PQZP | FG10963.1 | tubulin complex assembly |
| SGD closest match: | S000004190 | YKE2 | Prefoldin subunit 6 |
| CGD closest match: | CAL0000187726 | YKE2 | Tubulin-binding prefolding complex subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05134_1 | 44.26% | 122 | 5e-25 | MIA_05134_1 |
| UniRef50_W6MV81 | 42.62% | 122 | 2e-14 | Uncharacterized protein n=86 Tax=saccharomyceta TaxID=716545 RepID=W6MV81_9ASCO |
| PFD6_YEAST | 41.96% | 112 | 9e-16 | Prefoldin subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKE2 PE=1 SV=1 |
| Q6C8T7_YARLI | 37.70% | 122 | 1e-15 | YALI0D17086p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D17086g PE=4 SV=2 |
| A0A1E3PHI0_9ASCO | 35.94% | 128 | 3e-15 | Prefoldin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46718 PE=4 SV=1 |
| A0A060T5G8_BLAAD | 38.18% | 110 | 3e-14 | ARAD1B11198p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B11198g PE=4 SV=1 |
| A0A0J9XIP2_GEOCN | 36.45% | 107 | 3e-12 | Similar to Saccharomyces cerevisiae YLR200W YKE2 Subunit of the heterohexameric Gim/prefoldin protein complex involved in the folding of alpha-tubulin OS=Geotrichum candidum GN=BN980_GECA17s00703g PE=4 SV=1 |
| A0A1E4TES4_9ASCO | 43.64% | 55 | 4e-10 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31285 PE=4 SV=1 |
| A0A1D8PU06_CANAL | 47.27% | 55 | 2e-09 | Tubulin-binding prefolding complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YKE2 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0476
Protein family membership
- Prefoldin beta-like (IPR002777)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01920 (Prefoldin_2)
-
no IPR
Unintegrated signatures
-
-
-
SSF46579 (Prefoldin)
-
mobidb-lite (disord...)
Protein sequence
>MCA_00268_1 MSAVANQSQAGAPNAHQSTQELEEMINSINTLQNQLKDQIENRRLLEMQRQENQVVLEELEKLEKETIEKDSSSSEQIEP KVYKLTGPVLLPFSREEALQNVKKRLEFITGEIERVEKSLGDKQKEIMESRAKLSSVAGPAQQ
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex