Protein
MIA_05095_1
Length
172 amino acids
Browser: contig07:704242-704846-
Protein function
| EGGNOG: | 0PN6K | ATP7 | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a ATP6 static relative to the rotary elements |
|---|---|---|---|
| SGD closest match: | S000001499 | ATP7 | ATP synthase subunit d, mitochondrial |
| CGD closest match: | CAL0000180826 | ATP7 | ATP synthase subunit d, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_03759_1 | 85.55% | 173 | 2e-105 | MCA_03759_1 |
| A0A0J9XFG5_GEOCN | 76.47% | 170 | 2e-94 | ATP synthase subunit d, mitochondrial OS=Geotrichum candidum GN=BN980_GECA13s02463g PE=3 SV=1 |
| Q6CFH9_YARLI | 63.64% | 176 | 3e-81 | ATP synthase subunit d, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B06831g PE=3 SV=1 |
| A0A1E4TJR3_9ASCO | 62.65% | 166 | 1e-73 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_22959 PE=4 SV=1 |
| UniRef50_A0A1S7HTR4 | 56.90% | 174 | 6e-68 | ATP synthase subunit d, mitochondrial n=3 Tax=Zygosaccharomyces TaxID=4953 RepID=A0A1S7HTR4_9SACH |
| A0A060T5G3_BLAAD | 59.54% | 173 | 2e-70 | ATP synthase subunit d, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C05214g PE=3 SV=1 |
| ATP7_YEAST | 53.45% | 174 | 6e-69 | ATP synthase subunit d, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP7 PE=1 SV=2 |
| A0A1E3PF87_9ASCO | 55.28% | 161 | 7e-61 | ATP synthase subunit d, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53274 PE=3 SV=1 |
| Q59PV8_CANAL | 53.94% | 165 | 5e-59 | ATP synthase subunit d, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP7 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6833
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05873 (Mt_ATP-synt_D)
-
SSF161065 (ATP synt...)
-
PIRSF005514 (Mitoh_...)
-
no IPR
Unintegrated signatures
Protein sequence
>MIA_05095_1 MSVARTVKIDWAKIVSTLGLTGSTVSALSGFRKRHDDALKAVYELGTQPTSVDFAYYRKTLKNQEIVDKIEAAYKSFTPV TYDVSKQLKTIEAFEAKALANAKETSATIEKELQDLEATLSNIETARPFDQLTLDDLRKARPDIDAKVTEAVTKGRWETP GYDEKFGSAAAM
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)