Protein

MCA_03759_1

Length
173 amino acids

Gene name: ATP7

Description: ATP synthase subunit d, mitochondrial

Browser: contigC:999426-1000047+

RNA-seq: read pairs 40807, FPKM 2897.8, percentile rank 98.4% (100% = highest expression)

Protein function

Annotation:ATP7ATP synthase subunit d, mitochondrial
KEGG:K02138ATPeF0D F-type H+-transporting ATPase subunit d
EGGNOG:0PN6KATP7Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a ATP6 static relative to the rotary elements
SGD closest match:S000001499ATP7ATP synthase subunit d, mitochondrial
CGD closest match:CAL0000180826ATP7ATP synthase subunit d, mitochondrial

Protein alignments

%idAln lengthE-value
MIA_05095_185.55%1738e-94MIA_05095_1
A0A0J9XFG5_GEOCN76.74%1727e-84ATP synthase subunit d, mitochondrial OS=Geotrichum candidum GN=BN980_GECA13s02463g PE=3 SV=1
Q6CFH9_YARLI63.07%1762e-68ATP synthase subunit d, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B06831g PE=3 SV=1
A0A1E4TJR3_9ASCO61.31%1681e-64Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_22959 PE=4 SV=1
UniRef50_A0A1S7HTR458.05%1747e-60ATP synthase subunit d, mitochondrial n=3 Tax=Zygosaccharomyces TaxID=4953 RepID=A0A1S7HTR4_9SACH
A0A060T5G3_BLAAD59.54%1735e-61ATP synthase subunit d, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C05214g PE=3 SV=1
ATP7_YEAST54.02%1747e-61ATP synthase subunit d, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP7 PE=1 SV=2
A0A1E3PF87_9ASCO53.76%1737e-52ATP synthase subunit d, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53274 PE=3 SV=1
Q59PV8_CANAL54.34%1739e-51ATP synthase subunit d, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP7 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3124

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR008689
    ATP synthase, F0 complex, subunit D, mitochondrial
    1. PF05873 (Mt_ATP-synt_D)
    2. SSF161065 (ATP synt...)
    3. PIRSF005514 (Mitoh_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil

Protein sequence

>MCA_03759_1
MSVARATTKIDWAKIVSTLGLTGSTVSSLQGFRKRHDDALKSVVDLKAQPTEVDFSFYKKTLKNQDIVNKIEAAYNSFKP
VTYDTSKQLKTIEAFEAKALSNAKETAATIQKELGDLEATLSNIESARPFDQLTLDDLRKARPDIDAKVTEAVTKGRWET
PGYDEKFGSLVAM

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

GO:0015078 hydrogen ion transmembrane transporter activity

Cellular Component

GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)