Protein
MIA_05068_1
Length
95 amino acids
Browser: contig07:621517-621805-
Protein function
SGD closest match: | S000001010 | YHL018W | Putative pterin-4-alpha-carbinolamine dehydratase |
---|---|---|---|
CGD closest match: | CAL0000185556 | PHHB | 4a-hydroxytetrahydrobiopterin dehydratase |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_06027_1 | 62.637% | 91 | 7.20e-41 | MCA_06027_1 |
A0A0J9X597_GEOCN | 45.977% | 87 | 2.19e-18 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA03s00158g PE=4 SV=1 |
UniRef50_A0A0J9X597 | 45.977% | 87 | 4.48e-15 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X597_GEOCN |
A0A1E3PGA0_9ASCO | 39.241% | 79 | 9.28e-15 | Transcriptional coactivator/pterin dehydratase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47612 PE=4 SV=1 |
PHS_YEAST | 41.772% | 79 | 3.42e-14 | Putative pterin-4-alpha-carbinolamine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL018W PE=1 SV=1 |
Q5ACY8_CANAL | 36.923% | 65 | 8.81e-08 | 4a-hydroxytetrahydrobiopterin dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHHB PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6846
Protein family membership
- Transcriptional coactivator/pterin dehydratase (IPR001533)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
cd00488 (PCD_DCoH)
Residue annotation
-
DCoH dimer interac...
-
aromatic arch cd00...
-
DCoH /HNF-1 dimer ...
-
DCoH tetramer inte...
-
substrate binding ...
Protein sequence
>MIA_05068_1 MPPPSLSQIISAGWLYNAGSQTLSKTFTFANGFLPTWAFLQQLALYSHRVQHHPHIATKYNVVKLELHTDDEQSISDKDI RMAKKADSLFSQLTK
GO term prediction
Biological Process
GO:0006729 tetrahydrobiopterin biosynthetic process
Molecular Function
GO:0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity
Cellular Component
None predicted.