Protein
MCA_06027_1
Length
98 amino acids
Browser: contigD:3064805-3065102+
RNA-seq: read pairs 358, FPKM 44.7, percentile rank 62.8% (100% = highest expression)
Protein function
| KEGG: | K01724 | PCBD | 4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96] |
|---|---|---|---|
| EGGNOG: | 0PSNK | Pterin 4 alpha carbinolamine dehydratase | |
| SGD closest match: | S000001010 | YHL018W | Putative pterin-4-alpha-carbinolamine dehydratase |
| CGD closest match: | CAL0000185556 | PHHB | 4a-hydroxytetrahydrobiopterin dehydratase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05068_1 | 62.64% | 91 | 1e-39 | MIA_05068_1 |
| A0A0J9X597_GEOCN | 48.28% | 87 | 1e-21 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA03s00158g PE=4 SV=1 |
| UniRef50_A0A0J9X597 | 48.28% | 87 | 2e-18 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X597_GEOCN |
| A0A1E3PGA0_9ASCO | 47.89% | 71 | 2e-15 | Transcriptional coactivator/pterin dehydratase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47612 PE=4 SV=1 |
| PHS_YEAST | 39.74% | 78 | 1e-12 | Putative pterin-4-alpha-carbinolamine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL018W PE=1 SV=1 |
| Q5ACY8_CANAL | 34.04% | 94 | 5e-10 | 4a-hydroxytetrahydrobiopterin dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHHB PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3308
Protein family membership
- Transcriptional coactivator/pterin dehydratase (IPR001533)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
cd00488 (PCD_DCoH)
Residue annotation
-
DCoH dimer interac...
-
aromatic arch cd00...
-
DCoH /HNF-1 dimer ...
-
DCoH tetramer inte...
-
substrate binding ...
Protein sequence
>MCA_06027_1 MPPLPNPANLQKIIAAGWSYDSLAKSISKQYTFSKGFLPTWGFLNQLALYSHKVGHHPEIITKYNSVKLTLHTDDDSALT EKDISMAKKADNLFNQLK
GO term prediction
Biological Process
GO:0006729 tetrahydrobiopterin biosynthetic process
Molecular Function
GO:0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity
Cellular Component
None predicted.