Protein

MIA_05027_1

Length
223 amino acids

Browser: contig07:495029-496054-

Protein function

EGGNOG:0PG62YPT52gtp-binding protein
SGD closest match:S000005615VPS21Vacuolar protein sorting-associated protein 21
CGD closest match:CAL0000201225YPT52Rab family GTPase

Protein alignments

%idAln lengthE-value
MCA_05769_180.952%2101.02e-114MCA_05769_1
A0A167F051_9ASCO84.091%1761.05e-106Rab family GTPase VPS21 OS=Sugiyamaella lignohabitans GN=VPS21 PE=4 SV=1
UniRef50_A0A162NLV983.815%1731.47e-101GTP-binding protein ypt5 n=4 Tax=leotiomyceta TaxID=716546 RepID=A0A162NLV9_9PEZI
A0A060TBQ5_BLAAD81.250%1764.32e-105ARAD1D33902p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D33902g PE=4 SV=1
A0A1E4TFZ3_9ASCO81.034%1745.47e-102Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_108700 PE=4 SV=1
A0A0J9XA10_GEOCN74.528%2122.04e-100Similar to Saccharomyces cerevisiae YKR014C YPT52 Endosomal Rab family GTPase OS=Geotrichum candidum GN=BN980_GECA06s04784g PE=4 SV=1
A0A1E3PRR0_9ASCO81.609%1746.56e-95Ras-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81087 PE=4 SV=1
Q6C077_YARLI65.566%2121.46e-84YALI0F27181p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F27181g PE=4 SV=1
A0A1D8PFT9_CANAL62.088%1823.41e-74Rab family GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YPT52 PE=4 SV=1
VPS21_YEAST60.000%1706.82e-70Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3638

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 223

Detailed signature matches

  1. Family IPR001806
    Small GTPase superfamily
    1. PF00071 (Ras)
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. G3DSA:3.40.50...
  3. PR00449 (RASTRNSFRMNG)
  4. PS51419 (RAB)
  5. SM00173 (ras_sub_4)
  6. SM00174 (rho_sub_3)
  7. SM00175 (rab_sub_5)
  8. SM00176 (ran_sub_2)
  9. cd01860 (Rab5_related)

Residue annotation

  1. Rab subfamily moti...
  2. G1 box cd01860
  3. GTP/Mg2+ binding s...
  4. Rab subfamily moti...
  5. Switch I region cd...
  6. putative GEF inter...
  7. G2 box cd01860
  8. Rab family motif 1...
  9. putative GDI inter...
  10. effector interacti...
  11. Rab family motif 2...
  12. G3 box cd01860
  13. Switch II region c...
  14. Rab family motif 3...
  15. Rab family motif 4...
  16. Rab family motif 5...
  17. Rab subfamily moti...
  18. G4 box cd01860
  19. G5 box cd01860
  20. Rab subfamily moti...

Protein sequence

>MIA_05027_1
MSGSTPRSSVSSRFAQFKLVLLGESAVGKSSIVERFAKNVFDDYRESTIGAAFLTQTIQLDSNTTVKFEIWDTAGQERYK
SLAPMYYRNANCAVVVYDVTQAASLTRAKAWVKELQRQANENIVIALAGNKLDIVLEDESKRQVTTEEAQAYAKEAGLLF
FETSAKTGQNVTELFTAIAKKLPIESVLASRGGAAGAAGANSANARRGIDLKGSSAGATGCQC

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

None predicted.