Protein

MIA_04976_1

Length
183 amino acids

Browser: contig07:337168-337720-

Protein function

EGGNOG:0PN2JFG06112.12Fe-2S iron-sulfur cluster binding
SGD closest match:S000006173YAH1Adrenodoxin homolog, mitochondrial
CGD closest match:CAL0000201691YAH1Adrenodoxin

Protein alignments

%idAln lengthE-value
MCA_03167_191.667%1325.75e-81MCA_03167_1
A0A060TBS4_BLAAD87.692%1301.19e-74ARAD1D29700p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D29700g PE=4 SV=1
UniRef50_A5DXD185.156%1282.53e-70Uncharacterized protein n=29 Tax=Eukaryota TaxID=2759 RepID=A5DXD1_LODEL
A0A167EX34_9ASCO86.047%1292.13e-72Yah1p OS=Sugiyamaella lignohabitans GN=YAH1 PE=4 SV=1
A0A0J9X499_GEOCN86.290%1241.93e-70Similar to Saccharomyces cerevisiae YPL252C YAH1 Ferredoxin of the mitochondrial matrix required for formation of cellular iron-sulfur proteins OS=Geotrichum candidum GN=BN980_GECA02s07820g PE=4 SV=1
A0A1D8PJS2_CANAL83.594%1282.97e-70Adrenodoxin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YAH1 PE=4 SV=1
A0A1E3PIH3_9ASCO81.890%1276.37e-702Fe-2S iron-sulfur cluster binding domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83261 PE=4 SV=1
Q6CFZ5_YARLI83.871%1241.88e-68YALI0B02222p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B02222g PE=4 SV=1
ADRX_YEAST75.000%1321.90e-62Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9967
Predicted cleavage: 58

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 183

Detailed signature matches

  1. Family IPR001055
    Adrenodoxin
    1. PR00355 (ADRENODOXIN)
  2. Domain IPR012675
    Beta-grasp domain
    1. G3DSA:3.10.20.30
  3. Domain IPR001041
    2Fe-2S ferredoxin-type iron-sulfur binding domain
    1. SSF54292 (2Fe-2S fe...)
    2. cd00207 (fer2)
    3. PS51085 (2FE2S_FER_2)
    4. PF00111 (Fer2)
  4. SITE IPR018298
    Adrenodoxin, iron-sulphur binding site
    1. PS00814 (ADX)
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. SIGNAL_PEPTIDE (Sig...)
  3. SIGNAL_PEPTID... (S...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)

Residue annotation

  1. catalytic loop cd0...
  2. iron binding site ...

Protein sequence

>MIA_04976_1
MLPRFAAPSTTASLLAQITRALPAIQSFSRTRPALLSAAARYPASRPALTPLTALRFHGHLHKPKPGEELHVTFITKDGS
QHTYEVAAGDNLLDIAQANNLDMEGACGGSCACSTCHVIVDPDYYDIMEEPDDDENDMLDLAFGLTETSRLGCQIVMSKE
LDGLRVALPAMTRNLQARDFEKR

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0009055 electron carrier activity
GO:0051536 iron-sulfur cluster binding
GO:0051537 2 iron, 2 sulfur cluster binding

Cellular Component

None predicted.