Protein

MCA_03167_1

Length
199 amino acids

Gene name: YAH1

Description: Adrenodoxin homolog, mitochondrial; Ferredoxin of the mitochondrial matrix; required for formation of cellular iron-sulfur proteins; involved in heme A biosynthesis

Browser: contigB:3529195-3529795-

RNA-seq: read pairs 745, FPKM 46.0, percentile rank 63.5% (100% = highest expression)

Protein function

Annotation:YAH1Adrenodoxin homolog, mitochondrial; Ferredoxin of the mitochondrial matrix; required for formation of cellular iron-sulfur proteins; involved in heme A biosynthesis
EGGNOG:0PN2JFG06112.12Fe-2S iron-sulfur cluster binding
SGD closest match:S000006173YAH1Adrenodoxin homolog, mitochondrial
CGD closest match:CAL0000201691YAH1Adrenodoxin

Protein alignments

%idAln lengthE-value
MIA_04976_191.67%1329e-79MIA_04976_1
UniRef50_A5DXD183.82%1364e-71Uncharacterized protein n=29 Tax=Eukaryota TaxID=2759 RepID=A5DXD1_LODEL
A0A0J9X499_GEOCN82.71%1333e-71Similar to Saccharomyces cerevisiae YPL252C YAH1 Ferredoxin of the mitochondrial matrix required for formation of cellular iron-sulfur proteins OS=Geotrichum candidum GN=BN980_GECA02s07820g PE=4 SV=1
A0A060TBS4_BLAAD88.19%1271e-70ARAD1D29700p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D29700g PE=4 SV=1
A0A1D8PJS2_CANAL83.09%1368e-71Adrenodoxin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YAH1 PE=4 SV=1
A0A167EX34_9ASCO82.84%1342e-70Yah1p OS=Sugiyamaella lignohabitans GN=YAH1 PE=4 SV=1
A0A1E3PIH3_9ASCO80.15%1361e-702Fe-2S iron-sulfur cluster binding domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83261 PE=4 SV=1
Q6CFZ5_YARLI80.45%1332e-69YALI0B02222p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B02222g PE=4 SV=1
ADRX_YEAST77.86%1315e-63Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9773
Predicted cleavage: 74

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 199

Detailed signature matches

  1. Family IPR001055
    Adrenodoxin
    1. PR00355 (ADRENODOXIN)
  2. Domain IPR012675
    Beta-grasp domain
    1. G3DSA:3.10.20.30
  3. Domain IPR001041
    2Fe-2S ferredoxin-type iron-sulfur binding domain
    1. SSF54292 (2Fe-2S fe...)
    2. cd00207 (fer2)
    3. PS51085 (2FE2S_FER_2)
    4. PF00111 (Fer2)
  4. SITE IPR018298
    Adrenodoxin, iron-sulphur binding site
    1. PS00814 (ADX)

Residue annotation

  1. catalytic loop cd0...
  2. iron binding site ...

Protein sequence

>MCA_03167_1
MNTLLINSSKRTFGGLLKNQIKVCFYSSLTPKSSLIPSSSFSFINNNKPIIQSYNSQKTNNNLRHFSLSSPAFHGHLHKP
KPGEELHITFITKDGTQHTYEVCEGDNLLDIAQANNLDMEGACGGSCACSTCHVIVDPDFYDIMEEPDDDENDMLDLAFG
LTETSRLGCQIKMTKELDGLRVALPAMTRNLQARDFEKR

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0009055 electron carrier activity
GO:0051536 iron-sulfur cluster binding
GO:0051537 2 iron, 2 sulfur cluster binding

Cellular Component

None predicted.