Protein

MIA_04943_1

Length
118 amino acids

Browser: contig07:233097-233509-

Protein function

EGGNOG:0PQSMRPL37ABinds to the 23S rRNA (By similarity)
SGD closest match:S000004175RPL37A60S ribosomal protein L37-A
CGD closest match:CAL0000198698RPL37BRibosomal protein L37

Protein alignments

%idAln lengthE-value
MCA_06417_190.909%771.35e-46MCA_06417_1
UniRef50_A0A094DJS056.897%1168.74e-39Uncharacterized protein n=23 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094DJS0_9PEZI
A0A0J9X4R1_GEOCN84.932%733.48e-41Ribosomal protein L37 OS=Geotrichum candidum GN=BN980_GECA03s01759g PE=3 SV=1
RL37A_YEAST78.205%783.56e-4160S ribosomal protein L37-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL37A PE=1 SV=2
Q6C7E6_YARLI78.667%753.20e-40Ribosomal protein L37 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E01452g PE=3 SV=1
A0A060T3F3_BLAAD76.316%762.19e-40Ribosomal protein L37 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A09372g PE=3 SV=1
A0A1E4TCD3_9ASCO75.000%765.40e-39Ribosomal protein L37 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4038 PE=3 SV=1
A0A1D8PF45_CANAL75.641%781.03e-38Ribosomal protein L37 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL37B PE=3 SV=1
A0A1E3PCH3_9ASCO70.130%772.30e-38Ribosomal protein L37 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84566 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9906
Predicted cleavage: 96

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 118

Detailed signature matches

  1. Family IPR001569
    Ribosomal protein L37e
    1. MF_00547 (Ribosomal...)
    2. PF01907 (Ribosomal_...)
    3. PD005132
  2. Domain IPR011332
    Zinc-binding ribosomal protein
    1. SSF57829 (Zn-bindin...)
  3. Domain IPR011331
    Ribosomal protein L37ae/L37e
    1. G3DSA:2.20.25.30
  4. SITE IPR018267
    Ribosomal protein L37e, conserved site
    1. PS01077 (RIBOSOMAL_...)

Protein sequence

>MIA_04943_1
MWIGTPFNHKPFFIQYHSQQLYNQPAYLTYTSLIFQLCTGXGTSSFGKRHNKSHTLCRRCGRRSFHCQKKTCSSCGYPSA
KIRSFNWGQKAKRRHTTGTGRQQYLKTVTKKFKDGYKA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome