Protein

MCA_06417_1

Length
80 amino acids


Gene name: RPL37A

Description: 60S ribosomal protein L37-A

Browser: contigD:4138462-4139121+

RNA-seq: read pairs 28009, FPKM 4272.6, percentile rank 99.2% (100% = highest expression)

Protein function

Annotation:RPL37A60S ribosomal protein L37-A
KEGG:K02922RP-L37e large subunit ribosomal protein L37e
EGGNOG:0PQSMRPL37ABinds to the 23S rRNA (By similarity)
SGD closest match:S000004175RPL37A60S ribosomal protein L37-A
CGD closest match:CAL0000198698RPL37BRibosomal protein L37

Protein alignments

%idAln lengthE-value
MIA_04943_190.91%772e-45MIA_04943_1
Q6C7E6_YARLI84.42%772e-42Ribosomal protein L37 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E01452g PE=3 SV=1
A0A0J9X4R1_GEOCN84.62%785e-42Ribosomal protein L37 OS=Geotrichum candidum GN=BN980_GECA03s01759g PE=3 SV=1
UniRef50_A0A0J9XEL982.05%781e-38Ribosomal protein L37 n=17 Tax=Dikarya TaxID=451864 RepID=A0A0J9XEL9_GEOCN
A0A060T3F3_BLAAD81.82%775e-42Ribosomal protein L37 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A09372g PE=3 SV=1
RL37A_YEAST83.12%772e-4160S ribosomal protein L37-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL37A PE=1 SV=2
A0A1E4TCD3_9ASCO81.82%772e-41Ribosomal protein L37 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4038 PE=3 SV=1
A0A1E3PCH3_9ASCO75.32%773e-39Ribosomal protein L37 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84566 PE=3 SV=1
A0A1D8PF45_CANAL79.22%778e-39Ribosomal protein L37 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL37B PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9988
Predicted cleavage: 58

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 80

Detailed signature matches

    1. MF_00547 (Ribosomal...)
    2. PF01907 (Ribosomal_...)
    1. SSF57829 (Zn-bindin...)
    1. PS01077 (RIBOSOMAL_...)

Protein sequence

>MCA_06417_1
MTKGTTSFGKRHNKSHTLCRRCGRRSFHCQKKTCSSCGYPSAKIRSYNWGLKAKRRHTTGTGRQRYLKLVTKKFKEGAKA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome