Protein
MCA_06417_1
Length
80 amino acids
Gene name: RPL37A
Description: 60S ribosomal protein L37-A
Browser: contigD:4138462-4139121+
RNA-seq: read pairs 28009, FPKM 4272.6, percentile rank 99.2% (100% = highest expression)
Protein function
| Annotation: | RPL37A | 60S ribosomal protein L37-A | |
|---|---|---|---|
| KEGG: | K02922 | RP-L37e | large subunit ribosomal protein L37e |
| EGGNOG: | 0PQSM | RPL37A | Binds to the 23S rRNA (By similarity) |
| SGD closest match: | S000004175 | RPL37A | 60S ribosomal protein L37-A |
| CGD closest match: | CAL0000198698 | RPL37B | Ribosomal protein L37 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04943_1 | 90.91% | 77 | 2e-45 | MIA_04943_1 |
| Q6C7E6_YARLI | 84.42% | 77 | 2e-42 | Ribosomal protein L37 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E01452g PE=3 SV=1 |
| A0A0J9X4R1_GEOCN | 84.62% | 78 | 5e-42 | Ribosomal protein L37 OS=Geotrichum candidum GN=BN980_GECA03s01759g PE=3 SV=1 |
| UniRef50_A0A0J9XEL9 | 82.05% | 78 | 1e-38 | Ribosomal protein L37 n=17 Tax=Dikarya TaxID=451864 RepID=A0A0J9XEL9_GEOCN |
| A0A060T3F3_BLAAD | 81.82% | 77 | 5e-42 | Ribosomal protein L37 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A09372g PE=3 SV=1 |
| RL37A_YEAST | 83.12% | 77 | 2e-41 | 60S ribosomal protein L37-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL37A PE=1 SV=2 |
| A0A1E4TCD3_9ASCO | 81.82% | 77 | 2e-41 | Ribosomal protein L37 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4038 PE=3 SV=1 |
| A0A1E3PCH3_9ASCO | 75.32% | 77 | 3e-39 | Ribosomal protein L37 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84566 PE=3 SV=1 |
| A0A1D8PF45_CANAL | 79.22% | 77 | 8e-39 | Ribosomal protein L37 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL37B PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9988
Predicted cleavage: 58
Protein family membership
- Ribosomal protein L37e (IPR001569)
Domains and repeats
-
Domain
1
10
20
30
40
50
60
70
80
80
Detailed signature matches
Protein sequence
>MCA_06417_1 MTKGTTSFGKRHNKSHTLCRRCGRRSFHCQKKTCSSCGYPSAKIRSYNWGLKAKRRHTTGTGRQRYLKLVTKKFKEGAKA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome