Protein
MIA_04909_1
Length
336 amino acids
Browser: contig07:144217-145228+
Protein function
EGGNOG: | 0PGGA | FG07347.1 | elongation of fatty acids protein |
---|---|---|---|
SGD closest match: | S000000630 | ELO2 | Elongation of fatty acids protein 2 |
CGD closest match: | CAL0000190970 | FEN1 | Elongation of fatty acids protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_01542_1 | 65.646% | 294 | 1.96e-122 | MCA_01542_1 |
A0A0J9XAQ0_GEOCN | 68.683% | 281 | 4.31e-112 | Elongation of fatty acids protein OS=Geotrichum candidum GN=BN980_GECA08s00967g PE=3 SV=1 |
Q6CDY7_YARLI | 60.494% | 324 | 1.27e-108 | Elongation of fatty acids protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B20196g PE=3 SV=1 |
A0A161HL75_9ASCO | 60.063% | 318 | 1.10e-108 | Elongation of fatty acids protein OS=Sugiyamaella lignohabitans GN=ELO2 PE=3 SV=1 |
A0A1E3PDB0_9ASCO | 62.898% | 283 | 3.04e-105 | Elongation of fatty acids protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48253 PE=3 SV=1 |
A0A060T138_BLAAD | 61.721% | 337 | 6.04e-104 | Elongation of fatty acids protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C21098g PE=3 SV=1 |
UniRef50_W6Q5A1 | 58.423% | 279 | 2.73e-94 | Elongation of fatty acids protein n=19 Tax=leotiomyceta TaxID=716546 RepID=W6Q5A1_PENRF |
Q59PF0_CANAL | 56.738% | 282 | 6.85e-96 | Elongation of fatty acids protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FEN1 PE=3 SV=1 |
ELO2_YEAST | 60.573% | 279 | 1.11e-92 | Elongation of fatty acids protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO2 PE=1 SV=1 |
A0A1E4TAV7_9ASCO | 56.835% | 278 | 1.06e-90 | Elongation of fatty acids protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_130566 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1255
Protein family membership
- ELO family (IPR002076)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01151 (ELO)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_04909_1 MPPTNTLPDSLLQALAFQQPSLDRPFGFYLWDVVSYAVFKLTGGYDMNQFAFAAGTVPFSTLPPVVAIISAYYVVIFGGQ AVMTATGKAPIKLAKLFQIHNLNLTVLSLTLLLLLVEQLVPILLREGLFFAICNAASWTQPIVLVYYLNYLTKYLEFIDT VFLFLRRKPLTLLHTYHHGATALLCYTQLIGHTSVSWVPISLNLFVHVVMYWYYFQSSRGIRIWWKEWVTRLQIIQFVID LFFIYFATYTYYVTKYKIHFFPAFGTCAGEEFAAMSGCFILTSYLFLFIGFYIRVYSKGSKKRAAKASAGSEKEAVGVST GAAVSPASTVSKSRKA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane