Protein
MCA_01542_1
Length
344 amino acids
Gene name: ELO3
Description: Elongation of fatty acids protein 3
Browser: contigA:4761494-4762529-
RNA-seq: read pairs 3185, FPKM 114.1, percentile rank 80.9% (100% = highest expression)
Protein function
| Annotation: | ELO3 | Elongation of fatty acids protein 3 | |
|---|---|---|---|
| KEGG: | K10246 | ELO3 | fatty acid elongase 3 [EC:2.3.1.199] |
| EGGNOG: | 0PGGA | FG07347.1 | elongation of fatty acids protein |
| SGD closest match: | S000004364 | ELO3 | Elongation of fatty acids protein 3 |
| CGD closest match: | CAL0000190970 | FEN1 | Elongation of fatty acids protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04909_1 | 66.55% | 284 | 5e-128 | MIA_04909_1 |
| A0A0J9XAQ0_GEOCN | 64.44% | 284 | 4e-128 | Elongation of fatty acids protein OS=Geotrichum candidum GN=BN980_GECA08s00967g PE=3 SV=1 |
| A0A161HL75_9ASCO | 61.97% | 284 | 5e-122 | Elongation of fatty acids protein OS=Sugiyamaella lignohabitans GN=ELO2 PE=3 SV=1 |
| UniRef50_W6Q5A1 | 59.71% | 278 | 8e-117 | Elongation of fatty acids protein n=19 Tax=leotiomyceta TaxID=716546 RepID=W6Q5A1_PENRF |
| Q59PF0_CANAL | 58.45% | 284 | 1e-114 | Elongation of fatty acids protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FEN1 PE=3 SV=1 |
| A0A1E3PDB0_9ASCO | 60.51% | 276 | 4e-114 | Elongation of fatty acids protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48253 PE=3 SV=1 |
| Q6CDY7_YARLI | 61.79% | 280 | 5e-112 | Elongation of fatty acids protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B20196g PE=3 SV=1 |
| A0A060T138_BLAAD | 61.37% | 277 | 8e-111 | Elongation of fatty acids protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C21098g PE=3 SV=1 |
| A0A1E4TAV7_9ASCO | 57.86% | 280 | 1e-109 | Elongation of fatty acids protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_130566 PE=3 SV=1 |
| ELO3_YEAST | 57.91% | 278 | 3e-105 | Elongation of fatty acids protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO3 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0944
Protein family membership
- ELO family (IPR002076)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_01542_1 MSNITLTSSIPIPTPSTSLEQAFAFEIPSVNRPFGFSPWDIFSYVSNNVFHYDPSSFEFINNVTPLGSLKEVIAMLVLYY TVILGGRYIMTKFNLNPIKLQFLFQVHNLSLTIISSLLFVLLLEQILPMLFNHGVFYAICSTEAWTQKVLFIYYLNYITK YIEFIDTIFLFLRRKPLTFLHTYHHGATALLCYTQLIGHTSVSWVPISLNLFVHIIMYWYYFQSSRGIRVWWKQWVTRTQ IIQFVIDLVFIYFASYTYYATKYWPELPSMGTCAGEEFAAISGCVIITSYLFLFIGFYIRVYAKNASKKSAAAASKAAAA AVAESKPLSTGASTSTTTTKSRKI
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane