Protein
MIA_04848_1
Length
56 amino acids
Browser: contig06:1128864-1129086+
Protein function
EGGNOG: | 0PRVZ | RPS29 | 40S ribosomal protein S29 |
---|---|---|---|
SGD closest match: | S000004380 | RPS29A | 40S ribosomal protein S29-A |
CGD closest match: | CAL0000180472 | CAALFM_CR08480CA | Ribosomal 40S subunit protein S29A |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0F7RQS2_GEOCN | 94.643% | 56 | 4.84e-37 | Similar to Saccharomyces cerevisiae YLR388W RPS29A Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA02s08403g PE=4 SV=1 |
MCA_04841_1 | 92.857% | 56 | 1.23e-35 | MCA_04841_1 |
A0A060T1N7_BLAAD | 91.071% | 56 | 1.64e-35 | ARAD1C22066p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C22066g PE=4 SV=1 |
A0A1E3PEX9_9ASCO | 85.714% | 56 | 1.72e-34 | Ribosomal protein S14 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19878 PE=4 SV=1 |
Q6CFB0_YARLI | 78.571% | 56 | 8.00e-32 | YALI0B08748p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B08748g PE=4 SV=2 |
UniRef50_Q6CPG3 | 80.357% | 56 | 3.60e-27 | 40S ribosomal protein S29 n=4 Tax=Dikarya TaxID=451864 RepID=RS29_KLULA |
RS29A_YEAST | 76.786% | 56 | 6.78e-30 | 40S ribosomal protein S29-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS29A PE=1 SV=3 |
A0A1D8PTR4_CANAL | 73.214% | 56 | 1.18e-28 | Ribosomal 40S subunit protein S29A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR08480CA PE=4 SV=1 |
A0A1E4TKB6_9ASCO | 68.519% | 54 | 4.89e-26 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30440 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1037
Predicted cleavage: 46
Protein family membership
- Ribosomal protein S14 (IPR001209)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF00253 (Ribosomal_S14)
-

Unintegrated signatures
Protein sequence
>MIA_04848_1 MAHENVWYSHPRTYGKGSRQCRITASRNAVIRKYGLNICRQSFREKASDIGFVKYR
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome